S100A12 (S100 calcium binding protein A12)

Gene

• Entrez ID: 6283
• Gene name: S100 calcium binding protein A12
• Gene symbol: S100A12
• Synonyms (NCBI Gene): CAAF1, CAGC, CGRP, ENRAGE, MRP-6, MRP6, p6
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437615	hsa-miR-146a-5p	Microarray, qRT-PCR	22815788
MIRT437621	hsa-miR-146b-5p	Microarray, qRT-PCR	22815788

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002548	Process	Monocyte chemotaxis	TAS	18443896
GO:0005507	Function	Copper ion binding	TAS	18443896
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	7626002, 18443896
GO:0005515	Function	Protein binding	IPI	19386136, 36555597
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	18443896
GO:0005634	Component	Nucleus	IDA	15033494
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15033494
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS	7626002, 18443896
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	18443896
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	18443896
GO:0006805	Process	Xenobiotic metabolic process	IDA	11522286
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	8619876
GO:0008270	Function	Zinc ion binding	TAS	11522286, 18443896
GO:0016020	Component	Membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	TAS	18443896
GO:0031640	Process	Killing of cells of another organism	IDA	11522286
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	TAS	18443896
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	19386136
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	15033494
GO:0043406	Process	Positive regulation of MAP kinase activity	TAS	18443896
GO:0043542	Process	Endothelial cell migration	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	TAS	18443896
GO:0045576	Process	Mast cell activation	TAS	18443896
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050729	Process	Positive regulation of inflammatory response	TAS	18443896
GO:0050786	Function	RAGE receptor binding	IBA
GO:0050786	Function	RAGE receptor binding	IDA	19386136
GO:0050786	Function	RAGE receptor binding	IPI	15033494
GO:0050786	Function	RAGE receptor binding	TAS	18443896
GO:0050832	Process	Defense response to fungus	IDA	11522286
GO:0050832	Process	Defense response to fungus	IEA
GO:0050832	Process	Defense response to fungus	TAS	18443896
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS	18443896
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	11522286

Other IDs

• MIM: 603112
• HGNC: 10489
• e!Ensembl: ENSG00000163221

Protein

• UniProt ID: P80511
• Protein name: Protein S100-A12 (CGRP) (Calcium-binding protein in amniotic fluid 1) (CAAF1) (Calgranulin-C) (CAGC) (Extracellular newly identified RAGE-binding protein) (EN-RAGE) (Migration inhibitory factor-related protein 6) (MRP-6) (p6) (Neutrophil S100 protein) (S1
• Protein function: S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its pro-inflammatory activity involves recruitment of leukocytes, promotion of cytokine and che
• PDB: 1E8A, 1GQM, 1ODB, 2M9G, 2WC8, 2WCB, 2WCE, 2WCF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	4 → 46	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed by neutrophils, monocytes and activated macrophages. Expressed by eosinophils and macrophages in asthmatic airways in regions where mast cells accumulate. Found in high concentrations in the serum of patients su
• Sequence:

  MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
  LDANQDEQVDFQEFISLVAIALKAAHYHTHKE

• Sequence length: 92

Pathways

Reactome:

TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Neutrophil degranulation
Advanced glycosylation endproduct receptor signaling
TRAF6 mediated NF-kB activation