Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6283
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A12
Synonyms (NCBI Gene) Gene synonyms aliases
CAAF1, CAGC, CGRP, ENRAGE, MRP-6, MRP6, p6
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT437615 hsa-miR-146a-5p Microarray, qRT-PCR 22815788
MIRT437621 hsa-miR-146b-5p Microarray, qRT-PCR 22815788
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0002548 Process Monocyte chemotaxis TAS 18443896
GO:0005507 Function Copper ion binding TAS 18443896
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603112 10489 ENSG00000163221
Protein
UniProt ID P80511
Protein name Protein S100-A12 (CGRP) (Calcium-binding protein in amniotic fluid 1) (CAAF1) (Calgranulin-C) (CAGC) (Extracellular newly identified RAGE-binding protein) (EN-RAGE) (Migration inhibitory factor-related protein 6) (MRP-6) (p6) (Neutrophil S100 protein) (S1
Protein function S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its pro-inflammatory activity involves recruitment of leukocytes, promotion of cytokine and che
PDB 1E8A , 1GQM , 1ODB , 2M9G , 2WC8 , 2WCB , 2WCE , 2WCF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 4 46 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed by neutrophils, monocytes and activated macrophages. Expressed by eosinophils and macrophages in asthmatic airways in regions where mast cells accumulate. Found in high concentrations in the serum of patients su
Sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Sequence length 92
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Neutrophil degranulation
Advanced glycosylation endproduct receptor signaling
TRAF6 mediated NF-kB activation
<