S100A4 (S100 calcium binding protein A4)

Gene

• Entrez ID: 6275
• Gene name: S100 calcium binding protein A4
• Gene symbol: S100A4
• Synonyms (NCBI Gene): 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Repression	17143014
CREBBP	Unknown	17143014
EP300	Unknown	17143014
PTTG1	Activation	19351864
STAT4	Activation	22740693

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001837	Process	Epithelial to mesenchymal transition	TAS	14679171
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003779	Function	Actin binding	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	8204608
GO:0005515	Function	Protein binding	IPI	14640694, 15479433, 16189514, 19740107, 20421509, 20591429, 21516116, 22460785, 22483112, 23024279, 23752197, 24658140, 25416956, 26496610, 30083275, 31837246, 31980649, 32296183, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	26654597
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12118070, 15033494
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0042056	Function	Chemoattractant activity	IDA	26654597
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	20421509, 22483112
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	15033494
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15033494
GO:0050786	Function	RAGE receptor binding	IBA
GO:0050786	Function	RAGE receptor binding	IPI	15033494
GO:0050918	Process	Positive chemotaxis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 114210
• HGNC: 10494
• e!Ensembl: ENSG00000196154

Protein

• UniProt ID: P26447
• Protein name: Protein S100-A4 (Calvasculin) (Metastasin) (Placental calcium-binding protein) (Protein Mts1) (S100 calcium-binding protein A4)
• Protein function: Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed:16707441, PubMed:23752197, PubMed:30713770). Increases cell motility and invasivenes
• PDB: 1M31, 2LNK, 2MRD, 2Q91, 3C1V, 3CGA, 3KO0, 3M0W, 3ZWH, 4CFQ, 4CFR, 4ETO, 4HSZ, 5LPU, 6T58, 7PSP, 7PSQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	5 → 47	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed.
• Sequence:

  MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
  NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

• Sequence length: 101