S100A4 (S100 calcium binding protein A4)

Gene
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6275
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A4
Synonyms (NCBI Gene) Gene synonyms aliases
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
Transcription factors
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
Transcription factor Regulation Reference
CIITA Repression 17143014
CREBBP Unknown 17143014
EP300 Unknown 17143014
PTTG1 Activation 19351864
STAT4 Activation 22740693
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0001837 Process Epithelial to mesenchymal transition TAS 14679171
GO:0003723 Function RNA binding HDA 22658674
GO:0003779 Function Actin binding IEA
GO:0005509 Function Calcium ion binding IBA 21873635
GO:0005515 Function Protein binding IPI 14640694, 15479433, 16189514, 19740107, 20421509, 20591429, 21516116, 22483112, 23752197, 24658140, 25416956, 26496610, 30083275, 31837246, 31980649, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
114210 10494 ENSG00000196154
Protein
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID P26447
Protein name Protein S100-A4 (Calvasculin) (Metastasin) (Placental calcium-binding protein) (Protein Mts1) (S100 calcium-binding protein A4)
Protein function Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed:16707441, PubMed:23752197, PubMed:30713770). Increases cell motility and invasivenes
PDB 1M31 , 2LNK , 2MRD , 2Q91 , 3C1V , 3CGA , 3KO0 , 3M0W , 3ZWH , 4CFQ , 4CFR , 4ETO , 4HSZ , 5LPU , 6T58 , 7PSP , 7PSQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 5 → 47 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence 
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Sequence length 101
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Arthritis Degenerative polyarthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 16948116
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 21685359
Medulloblastoma Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009 17579622
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 29179997
Show/Hide Text Mining Associations (165)
Associations from Text Mining
Disease Name Relationship Type References
Acrocephalosyndactylia Associate 37118659
Adenocarcinoma Associate 22853000, 24215488
Adenocarcinoma Stimulate 28921916
Adenocarcinoma Of Esophagus Associate 35326507
Adenocarcinoma of Lung Associate 16367903
Adenocarcinoma of Lung Stimulate 27127879
Adenoma Stimulate 19043399
Adenoma Inhibit 25880590
Alveolitis Extrinsic Allergic Stimulate 32755764
Ameloblastoma Associate 36748192