S100A1 (S100 calcium binding protein A1)

Gene

• Entrez ID: 6271
• Gene name: S100 calcium binding protein A1
• Gene symbol: S100A1
• Synonyms (NCBI Gene): S100, S100-alpha, S100A
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021738	hsa-miR-132-3p	Microarray	17612493
MIRT025080	hsa-miR-181a-5p	Microarray	17612493
MIRT028823	hsa-miR-26b-5p	Microarray	19088304
MIRT052908	hsa-miR-138-5p	Immunoblot, Luciferase reporter assay	24244340
MIRT052908	hsa-miR-138-5p	Immunoblot, Luciferase reporter assay	24244340
MIRT2320413	hsa-miR-342-5p	CLIP-seq
MIRT2320414	hsa-miR-4447	CLIP-seq
MIRT2320415	hsa-miR-4472	CLIP-seq
MIRT2320416	hsa-miR-4651	CLIP-seq
MIRT2320417	hsa-miR-4664-5p	CLIP-seq
MIRT2320418	hsa-miR-541	CLIP-seq
MIRT2320419	hsa-miR-608	CLIP-seq
MIRT2320420	hsa-miR-654-5p	CLIP-seq
MIRT2320413	hsa-miR-342-5p	CLIP-seq
MIRT2320414	hsa-miR-4447	CLIP-seq
MIRT2320415	hsa-miR-4472	CLIP-seq
MIRT2320416	hsa-miR-4651	CLIP-seq
MIRT2320417	hsa-miR-4664-5p	CLIP-seq
MIRT2320418	hsa-miR-541	CLIP-seq
MIRT2320419	hsa-miR-608	CLIP-seq
MIRT2320420	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	10913138, 15171681, 16189514, 20591429, 21516116, 25416956, 26871637, 29997244, 31515488, 31837246, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	12118070
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0008016	Process	Regulation of heart contraction	NAS	12804600
GO:0016529	Component	Sarcoplasmic reticulum	IBA	21873635
GO:0016529	Component	Sarcoplasmic reticulum	IDA	12804600
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0032991	Component	Protein-containing complex	NAS	14638689
GO:0035556	Process	Intracellular signal transduction	NAS	12804600
GO:0042802	Function	Identical protein binding	IPI	10913138, 15171681, 16189514, 21296671, 25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	10913138
GO:0044548	Function	S100 protein binding	IBA	21873635
GO:0044548	Function	S100 protein binding	IPI	10913138
GO:0048306	Function	Calcium-dependent protein binding	IBA	21873635
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	IDA	24244340
GO:0051117	Function	ATPase binding	IPI	12804600
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	24244340

Other IDs

• MIM: 176940
• HGNC: 10486
• e!Ensembl: ENSG00000160678

Protein

• UniProt ID: P23297
• Protein name: Protein S100-A1 (S-100 protein alpha chain) (S-100 protein subunit alpha) (S100 calcium-binding protein A1)
• Protein function: Small calcium binding protein that plays important roles in several biological processes such as Ca(2+) homeostasis, chondrocyte biology and cardiomyocyte regulation (PubMed:12804600). In response to an increase in intracellular Ca(2+) levels, b
• PDB: 2L0P, 2LHL, 2LLS, 2LLT, 2LLU, 2LP2, 2LP3, 2LUX, 2M3W, 5K89
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	5 → 47	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly prevalent in heart (PubMed:12804600, PubMed:1384693). Also found in lesser quantities in skeletal muscle and brain (PubMed:1384693). {ECO:0000269|PubMed:12804600, ECO:0000269|PubMed:1384693}.
• Sequence:

  MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK
  ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

• Sequence length: 94

Pathways

Reactome:

Regulation of TLR by endogenous ligand