Gene Gene information from NCBI Gene database.
Entrez ID 6257
Gene name Retinoid X receptor beta
Gene symbol RXRB
Synonyms (NCBI Gene)
DAUDI6H-2RIIBPNR2B2RCoR-1RXR-betaRXRbeta
Chromosome 6
Chromosome location 6p21.32
Summary This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptor
miRNA miRNA information provided by mirtarbase database.
276
miRTarBase ID miRNA Experiments Reference
MIRT004176 hsa-miR-197-3p Microarray 16822819
MIRT004235 hsa-miR-346 Microarray 16822819
MIRT016771 hsa-miR-335-5p Microarray 18185580
MIRT028819 hsa-miR-26b-5p Microarray 19088304
MIRT051998 hsa-let-7b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 12767074
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 12767074
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
180246 10478 ENSG00000204231
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P28702
Protein name Retinoic acid receptor RXR-beta (Nuclear receptor subfamily 2 group B member 2) (Retinoid X receptor beta)
Protein function Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR
PDB 1H9U , 1UHL , 5HJP , 5I4V , 5KYA , 5KYJ , 7A78
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 203 272 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 331 513 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in aortic endothelial cells (at protein level) (PubMed:28167758). Expressed in monocytes (PubMed:26463675). Expressed in a variety of tumor cell lines. {ECO:0000269|PubMed:26463675, ECO:0000269|PubMed:28167758, ECO:0000269|Pu
Sequence
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKR
EAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLI
GDTPIDTFLMEMLEAPHQLA
Sequence length 533
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  PPAR signaling pathway
Th17 cell differentiation
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Parathyroid hormone synthesis, secretion and action
Pathways in cancer
Transcriptional misregulation in cancer
Chemical carcinogenesis - receptor activation
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Gastric cancer
Lipid and atherosclerosis
  PPARA activates gene expression
Nuclear Receptor transcription pathway
Signaling by Retinoic Acid
NR1H2 & NR1H3 regulate gene expression linked to lipogenesis
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
NR1H2 & NR1H3 regulate gene expression to limit cholesterol uptake
NR1H2 & NR1H3 regulate gene expression linked to triglyceride lipolysis in adipose
NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis
NR1H2 & NR1H3 regulate gene expression linked to gluconeogenesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
14
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs186232872 RCV005936842
Cervical cancer Benign rs186232872 RCV005936843
Familial cancer of breast Benign rs186232872 RCV005936841
RXRB-related disorder Benign; Likely benign rs6531, rs186232872, rs61730281, rs2150679110, rs184921826, rs775312696, rs188577937, rs201700806, rs143154990 RCV003975833
RCV003906821
RCV003941788
RCV003917378
RCV003959145
RCV003932005
RCV003944636
RCV003983585
RCV003916033
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Inhibit 12514092
Bile Duct Neoplasms Associate 18375961
Breast Neoplasms Associate 8384307
Carcinoma Basal Cell Associate 12514092
Carcinoma Embryonal Associate 1736309
Carcinoma Intraductal Noninfiltrating Associate 11092983
Esophageal Squamous Cell Carcinoma Associate 29098164
Eyelid Neoplasms Associate 26503156
Gallstones Associate 18375961
Granulomatosis with Polyangiitis Associate 16526951, 19811264