Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6251
Gene name Gene Name - the full gene name approved by the HGNC.
Ras suppressor protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RSU1
Synonyms (NCBI Gene) Gene synonyms aliases
RSP-1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initia
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025432 hsa-miR-34a-5p Proteomics 21566225
MIRT025779 hsa-miR-7-5p Microarray 19073608
MIRT733950 hsa-miR-421 In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting 32884301
MIRT1321529 hsa-miR-122 CLIP-seq
MIRT1321530 hsa-miR-1245b-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20926685, 23414517, 25416956, 28514442, 29892012
GO:0005829 Component Cytosol TAS
GO:0005925 Component Focal adhesion IDA 20926685
GO:0007165 Process Signal transduction IBA 21873635
GO:0010810 Process Regulation of cell-substrate adhesion IMP 20926685
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
179555 10464 ENSG00000148484
Protein
UniProt ID Q15404
Protein name Ras suppressor protein 1 (RSP-1) (Rsu-1)
Protein function Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.
PDB 7D2S , 7D2T , 7D2U , 7LT8 , 7LT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 40 98 Leucine rich repeat Repeat
PF13855 LRR_8 79 121 Leucine rich repeat Repeat
PF13855 LRR_8 96 146 Leucine rich repeat Repeat
PF13855 LRR_8 134 192 Leucine rich repeat Repeat
Sequence
MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIA
ELKNLEVLNFFNNQIEEL
PTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNN
L
SENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELT
QLKELHIQGNRL
TVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSE
TYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
Sequence length 277
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of cytoskeletal remodeling and cell spreading by IPP complex components
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Osteoporosis Osteoporosis, Age-Related, Osteoporosis, Osteoporosis, Senile, Post-Traumatic Osteoporosis rs72658152, rs72667023, rs587776916, rs72656370, rs768615287 18924182
Unknown
Disease term Disease name Evidence References Source
Mental Depression Mental Depression GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Adenomatous Polyposis Coli Associate 21411865
Alzheimer Disease Associate 36471423
Breast Neoplasms Associate 18436335, 28423706, 31296919, 32751711
Breast Neoplasms Stimulate 30621163
Carcinogenesis Inhibit 18436335
Cardiomyopathy Hypertrophic Associate 31243064
Glioma Associate 18436335, 31123330
Graves Disease Inhibit 34867951
Hypertrophy Left Ventricular Associate 31243064
Inflammation Stimulate 37640791