Gene Gene information from NCBI Gene database.
Entrez ID 6251
Gene name Ras suppressor protein 1
Gene symbol RSU1
Synonyms (NCBI Gene)
RSP-1
Chromosome 10
Chromosome location 10p13
Summary This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initia
miRNA miRNA information provided by mirtarbase database.
376
miRTarBase ID miRNA Experiments Reference
MIRT025432 hsa-miR-34a-5p Proteomics 21566225
MIRT025779 hsa-miR-7-5p Microarray 19073608
MIRT733950 hsa-miR-421 In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting 32884301
MIRT1321529 hsa-miR-122 CLIP-seq
MIRT1321530 hsa-miR-1245b-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20926685, 23414517, 25416956, 28514442, 29892012, 33961781
GO:0005829 Component Cytosol TAS
GO:0005925 Component Focal adhesion IDA 20926685
GO:0007165 Process Signal transduction IEA
GO:0007165 Process Signal transduction TAS 1508180
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
179555 10464 ENSG00000148484
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15404
Protein name Ras suppressor protein 1 (RSP-1) (Rsu-1)
Protein function Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.
PDB 7D2S , 7D2T , 7D2U , 7LT8 , 7LT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 40 98 Leucine rich repeat Repeat
PF13855 LRR_8 79 121 Leucine rich repeat Repeat
PF13855 LRR_8 96 146 Leucine rich repeat Repeat
PF13855 LRR_8 134 192 Leucine rich repeat Repeat
Sequence
MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIA
ELKNLEVLNFFNNQIEEL
PTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNN
L
SENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELT
QLKELHIQGNRL
TVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSE
TYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
Sequence length 277
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of cytoskeletal remodeling and cell spreading by IPP complex components