Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6100
Gene name Gene Name - the full gene name approved by the HGNC.
RP9 pre-mRNA splicing factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RP9
Synonyms (NCBI Gene) Gene synonyms aliases
PAP-1, PAP1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene can be bound and phosphorylated by the protooncogene PIM1 product, a serine/threonine protein kinase . This protein localizes in nuclear speckles containing the splicing factors, and has a role in pre-mRNA splicing. CBF1-i
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894039 T>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT2093809 hsa-miR-1321 CLIP-seq
MIRT2093810 hsa-miR-150 CLIP-seq
MIRT2093811 hsa-miR-214 CLIP-seq
MIRT2093812 hsa-miR-2964a-5p CLIP-seq
MIRT2093813 hsa-miR-3607-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 15652350, 32296183
GO:0005634 Component Nucleus IEA
GO:0005785 Component Signal recognition particle receptor complex IEA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607331 10288 ENSG00000164610
Protein
UniProt ID Q8TA86
Protein name Retinitis pigmentosa 9 protein (Pim-1-associated protein) (PAP-1)
Protein function Is thought to be a target protein for the PIM1 kinase. May play some roles in B-cell proliferation in association with PIM1 (By similarity).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Appears to be expressed in a wide range of tissues.
Sequence
MSSRPGREDVGAAGARRPREPPEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLI
KEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRYGHRTGDKEC
PFFIKGNQKLEQFRVAHEDPMYDIIRDNKRHEKDVRIQQLKQLLEDSTSDEDRSSSSSSE
GKEKHKKKKKKEKHKKRKKEKKKKKKRKHKSSKSNEGSDSE
Sequence length 221
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Spliceosome  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
retinal dystrophy Retinal dystrophy N/A N/A ClinVar
Retinitis Pigmentosa retinitis pigmentosa, retinitis pigmentosa 9, Retinitis Pigmentosa, Dominant N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Retinitis Pigmentosa Associate 16799052, 21347327, 23559859, 8808602