RNASE6 (ribonuclease A family member 6)

Gene

• Entrez ID: 6039
• Gene name: Ribonuclease A family member 6
• Gene symbol: RNASE6
• Synonyms (NCBI Gene): RAD1, RNS6, RNasek6
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The protein encoded by this gene is a member of the ribonuclease A superfamily and functions in the urinary tract. The protein has broad-spectrum antimicrobial activity against pathogenic bacteria. [provided by RefSeq, Nov 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030200	hsa-miR-26b-5p	Microarray	19088304
MIRT1308628	hsa-miR-137	CLIP-seq
MIRT1308629	hsa-miR-140-5p	CLIP-seq
MIRT1308630	hsa-miR-214	CLIP-seq
MIRT1308631	hsa-miR-3619-5p	CLIP-seq
MIRT1308632	hsa-miR-4659a-3p	CLIP-seq
MIRT1308633	hsa-miR-4659b-3p	CLIP-seq
MIRT1308634	hsa-miR-4681	CLIP-seq
MIRT1308635	hsa-miR-4778-3p	CLIP-seq
MIRT1308636	hsa-miR-4795-5p	CLIP-seq
MIRT1308637	hsa-miR-761	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004540	Function	RNA nuclease activity	IBA
GO:0004540	Function	RNA nuclease activity	IDA	9826755
GO:0004540	Function	RNA nuclease activity	TAS	8836175
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	8836175
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25075772
GO:0005764	Component	Lysosome	IEA
GO:0006401	Process	RNA catabolic process	TAS	8836175
GO:0006952	Process	Defense response	TAS	8836175
GO:0016787	Function	Hydrolase activity	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	25075772
GO:0031410	Component	Cytoplasmic vesicle	IDA	25075772
GO:0042742	Process	Defense response to bacterium	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	25075772
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	25075772
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	25075772
GO:0051607	Process	Defense response to virus	IDA	9826755
GO:0051607	Process	Defense response to virus	IDA	9826755
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	25075772

Other IDs

• MIM: 601981
• HGNC: 10048
• e!Ensembl: ENSG00000169413

Protein

• UniProt ID: Q93091
• Protein name: Ribonuclease K6 (RNase K6) (EC 3.1.27.-)
• Protein function: Ribonuclease which shows a preference for the pyrimidines uridine and cytosine (PubMed:27013146, PubMed:8836175). Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii,
• PDB: 4X09, 5OAB, 6ENP, 6MV6, 6MV7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	29 → 147	Pancreatic ribonuclease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in spleen (at protein level) (PubMed:25075772, PubMed:8836175). Has little or no expression in healthy kidneys (at protein level) (PubMed:25075772). Detected in interstitial leukocytes in infected kidneys (at protein l
• Sequence:

  MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHC
  KHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAA
  QYKFFIVACDPPQKSDPPYKLVPVHLDSIL

• Sequence length: 150

Pathways

Reactome:

Antimicrobial peptides

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alzheimer Disease	Associate	35896049	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	35896049	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	36189307	★☆☆☆☆ Found in Text Mining only