Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	6019
Gene name	Relaxin 2
Gene symbol	RLN2
Synonyms (NCBI Gene)	H2H2-RLXRLXH2bA12D24.1.1bA12D24.1.2
Chromosome	9
Chromosome location	9p24.1
Summary	This gene encodes a member of the relaxin subfamily and insulin superfamily of peptide hormones. In humans there are three non-allelic relaxin genes. This gene encodes multiple protein isoforms, at least one of which undergoes proteolytic processing. This

Show/Hide all (35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT609113	hsa-miR-8084	HITS-CLIP	24906430
MIRT609112	hsa-miR-7153-3p	HITS-CLIP	24906430
MIRT571257	hsa-miR-1255a	HITS-CLIP	24906430
MIRT571256	hsa-miR-1255b-5p	HITS-CLIP	24906430
MIRT609111	hsa-miR-4789-5p	HITS-CLIP	24906430
MIRT609110	hsa-miR-7156-3p	HITS-CLIP	24906430
MIRT609109	hsa-miR-6505-5p	HITS-CLIP	24906430
MIRT571257	hsa-miR-1255a	PAR-CLIP	20371350
MIRT571256	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT447022	hsa-miR-548n	PAR-CLIP	22100165
MIRT447021	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447020	hsa-miR-548k	PAR-CLIP	22100165
MIRT447019	hsa-miR-8054	PAR-CLIP	22100165
MIRT447017	hsa-miR-4453	PAR-CLIP	22100165
MIRT447018	hsa-miR-4538	PAR-CLIP	22100165
MIRT447022	hsa-miR-548n	PAR-CLIP	22100165
MIRT447021	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447020	hsa-miR-548k	PAR-CLIP	22100165
MIRT447019	hsa-miR-8054	PAR-CLIP	22100165
MIRT447017	hsa-miR-4453	PAR-CLIP	22100165
MIRT447018	hsa-miR-4538	PAR-CLIP	22100165
MIRT571257	hsa-miR-1255a	PAR-CLIP	20371350
MIRT571256	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT447022	hsa-miR-548n	PAR-CLIP	22100165
MIRT447021	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447020	hsa-miR-548k	PAR-CLIP	22100165
MIRT447019	hsa-miR-8054	PAR-CLIP	22100165
MIRT447017	hsa-miR-4453	PAR-CLIP	22100165
MIRT447018	hsa-miR-4538	PAR-CLIP	22100165
MIRT447022	hsa-miR-548n	PAR-CLIP	22100165
MIRT447021	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447020	hsa-miR-548k	PAR-CLIP	22100165
MIRT447019	hsa-miR-8054	PAR-CLIP	22100165
MIRT447017	hsa-miR-4453	PAR-CLIP	22100165
MIRT447018	hsa-miR-4538	PAR-CLIP	22100165

Show/Hide all (2)

Transcription factor	Regulation	Reference
NR3C1	Unknown	15149733
PGR	Unknown	15149733

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007565	Process	Female pregnancy	TAS	6548702
GO:0010628	Process	Positive regulation of gene expression	IDA	11459784
GO:0045766	Process	Positive regulation of angiogenesis	IMP	16049981
GO:0050790	Process	Regulation of catalytic activity	IDA	16049981

MIM	HGNC	e!Ensembl
179740	10027	ENSG00000107014

P04090

Protein name

Prorelaxin H2 [Cleaved into: Relaxin B chain; Relaxin A chain]

Protein function

Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.

PDB

2MV1 , 6RLX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00049	Insulin	32 → 185	Insulin/IGF/Relaxin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 is relatively abundant in placenta. It is in much lower abundance in the prostate gland. Not detected in the ovary. {ECO:

Sequence

MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQE
DAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLK
DSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRS
LARFC

Sequence length

185

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Relaxin signaling pathway		G alpha (s) signalling events Relaxin receptors ADORA2B mediated anti-inflammatory cytokines production

RLN2 (relaxin 2)