Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5992
Gene name Gene Name - the full gene name approved by the HGNC.
Regulatory factor X4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RFX4
Synonyms (NCBI Gene) Gene synonyms aliases
NYD-SP10
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X3, a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1302415 hsa-miR-129-3p CLIP-seq
MIRT1302416 hsa-miR-3907 CLIP-seq
MIRT1302417 hsa-miR-4687-5p CLIP-seq
MIRT1302418 hsa-miR-548q CLIP-seq
MIRT1302419 hsa-miR-665 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 16893423
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603958 9985 ENSG00000111783
Protein
UniProt ID Q33E94
Protein name Transcription factor RFX4 (Regulatory factor X 4) (Testis development protein NYD-SP10)
Protein function Transcription factor that plays a role in early brain development. May activate transcription by interacting directly with the X-box. May activate transcription from CX3CL1 promoter through the X-box during brain development. May be required for
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02257 RFX_DNA_binding 58 136 RFX DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1: Expressed in brain and gliomas (at protein level). Isoform 2: Testis-specific (at protein level). Isoform 3: Testis-specific (at protein level). Isoform 3: Expressed at a higher level in adult testes and ejaculated spermatoz
Sequence
MHCGLLEEPDMDSTESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPA
TLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLG
TRGQSKYHYYGIAVKE
SSQYYDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPE
FPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHML
PVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHD
LPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITK
QTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSL
KKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANEL
MRAMKGEGSTAEVREEIILTEAAAPTPSPVPSFSPAKSATSVEVPPPSSPVSNPSPEYTG
LSTTGAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGY
TGSYNYGSYGNQHPHPMQSQYPALPHDTAISGPLHYAPYHRSSAQYPFNSPTSRMEPCLM
SSTPRLHPTPVTPRWPEVPSANTCYTSPSVHSARYGNSSDMYTPLTTRRNSEYEHMQHFP
GFAYINGEASTGWAK
Sequence length 735
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Glaucoma Glaucoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 33658631
Autism Spectrum Disorder Associate 33658631
Autistic Disorder Associate 18378158
Bipolar Disorder Associate 24393808
Brain Diseases Associate 18378158
Breast Neoplasms Associate 11682486
Disease Associate 33658631
Glioma Associate 16271074
Intellectual Disability Associate 33658631
Narcolepsy Associate 33837283