Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5987
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM27
Synonyms (NCBI Gene) Gene synonyms aliases
RFP, RNF76
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039436 hsa-miR-421 CLASH 23622248
MIRT052686 hsa-miR-1260b CLASH 23622248
MIRT709741 hsa-miR-586 HITS-CLIP 19536157
MIRT709740 hsa-miR-6870-3p HITS-CLIP 19536157
MIRT709739 hsa-miR-942-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10976108
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0001650 Component Fibrillar center IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602165 9975 ENSG00000204713
Protein
UniProt ID P14373
Protein name Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (Ret finger protein) (Tripartite motif-containing protein 27)
Protein function E3 ubiquitin-protein ligase that mediates ubiquitination of various substrates and thereby plays a role in diffent processes including proliferation, innate immunity, apoptosis, immune response or autophagy (PubMed:22829933, PubMed:24144979, Pub
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 16 56 Domain
PF00643 zf-B_box 91 132 B-box zinc finger Domain
PF13765 PRY 318 366 SPRY-associated domain Family
PF00622 SPRY 370 487 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis namely within the seminiferous tubules. {ECO:0000269|PubMed:12445133}.
Sequence
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPL
EEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCF
IAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPL
IICPMSGIDGFSGHVGNHGHSMETSP
Sequence length 513
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    SUMOylation of ubiquitinylation proteins
Regulation of PTEN stability and activity
Suppression of apoptosis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hyperthyroidism Hyperthyroidism N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26356813
Adenoma Pleomorphic Associate 34985683
Albuminuria Associate 37872228
Breast Neoplasms Associate 37307465
Carcinogenesis Associate 39266987, 9599022
Carcinoma Hepatocellular Associate 36217828
Carcinoma Intraductal Noninfiltrating Associate 30610524, 31162284, 34985683
Carcinoma Non Small Cell Lung Associate 33264103, 33448640, 34932879
Carcinoma Ovarian Epithelial Associate 23011823
Carcinoma Renal Cell Associate 33173411