Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5987
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM27
Synonyms (NCBI Gene) Gene synonyms aliases	RFP, RNF76
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the

Show/Hide all(250)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039436	hsa-miR-421	CLASH	23622248
MIRT052686	hsa-miR-1260b	CLASH	23622248
MIRT709741	hsa-miR-586	HITS-CLIP	19536157
MIRT709740	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT709739	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709738	hsa-miR-4666a-5p	HITS-CLIP	19536157
MIRT709737	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT709736	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT709735	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT709734	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT645245	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT645244	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT645243	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT645242	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT645241	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT645240	hsa-miR-6735-3p	HITS-CLIP	23824327
MIRT645239	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT563440	hsa-miR-3609	PAR-CLIP	20371350
MIRT563439	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT563438	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT563437	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT563441	hsa-miR-548m	PAR-CLIP	20371350
MIRT563440	hsa-miR-3609	PAR-CLIP	20371350
MIRT563439	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT563438	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT563437	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT737417	hsa-miR-30b-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31921311
MIRT709741	hsa-miR-586	HITS-CLIP	19536157
MIRT709740	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT709739	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709738	hsa-miR-4666a-5p	HITS-CLIP	19536157
MIRT709737	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT709736	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT709735	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT709734	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT645245	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT645244	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT645243	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT645242	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT645241	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT645240	hsa-miR-6735-3p	HITS-CLIP	23824327
MIRT645239	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT563440	hsa-miR-3609	PAR-CLIP	20371350
MIRT563439	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT563438	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT563437	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT563441	hsa-miR-548m	PAR-CLIP	20371350
MIRT563440	hsa-miR-3609	PAR-CLIP	20371350
MIRT563439	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT563438	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT563437	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT755621	hsa-miR-324-3p	Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence	34632544
MIRT1453701	hsa-miR-1245	CLIP-seq
MIRT1453702	hsa-miR-1273e	CLIP-seq
MIRT1453703	hsa-miR-1286	CLIP-seq
MIRT1453704	hsa-miR-145	CLIP-seq
MIRT1453705	hsa-miR-146a	CLIP-seq
MIRT1453706	hsa-miR-146b-5p	CLIP-seq
MIRT1453707	hsa-miR-1913	CLIP-seq
MIRT1453708	hsa-miR-2392	CLIP-seq
MIRT1453709	hsa-miR-2681	CLIP-seq
MIRT1453710	hsa-miR-3147	CLIP-seq
MIRT1453711	hsa-miR-3169	CLIP-seq
MIRT755621	hsa-miR-324-3p	CLIP-seq
MIRT1453712	hsa-miR-3605-5p	CLIP-seq
MIRT1453713	hsa-miR-3616-5p	CLIP-seq
MIRT1453714	hsa-miR-3647-5p	CLIP-seq
MIRT1453715	hsa-miR-3660	CLIP-seq
MIRT1453716	hsa-miR-3918	CLIP-seq
MIRT1453717	hsa-miR-4251	CLIP-seq
MIRT1453718	hsa-miR-4259	CLIP-seq
MIRT1453719	hsa-miR-4488	CLIP-seq
MIRT1453720	hsa-miR-4512	CLIP-seq
MIRT1453721	hsa-miR-4526	CLIP-seq
MIRT1453722	hsa-miR-4534	CLIP-seq
MIRT1453723	hsa-miR-4635	CLIP-seq
MIRT1453724	hsa-miR-4653-3p	CLIP-seq
MIRT1453725	hsa-miR-4697-5p	CLIP-seq
MIRT1453726	hsa-miR-4740-5p	CLIP-seq
MIRT1453727	hsa-miR-4747-5p	CLIP-seq
MIRT1453728	hsa-miR-4795-5p	CLIP-seq
MIRT1453729	hsa-miR-513b	CLIP-seq
MIRT1453730	hsa-miR-571	CLIP-seq
MIRT1453731	hsa-miR-573	CLIP-seq
MIRT1453732	hsa-miR-589	CLIP-seq
MIRT1453733	hsa-miR-656	CLIP-seq
MIRT2136073	hsa-miR-134	CLIP-seq
MIRT2136074	hsa-miR-3118	CLIP-seq
MIRT2136075	hsa-miR-3164	CLIP-seq
MIRT2136076	hsa-miR-4501	CLIP-seq
MIRT2136077	hsa-miR-455-3p	CLIP-seq
MIRT2136078	hsa-miR-4719	CLIP-seq
MIRT2357050	hsa-miR-1193	CLIP-seq
MIRT1453701	hsa-miR-1245	CLIP-seq
MIRT1453702	hsa-miR-1273e	CLIP-seq
MIRT1453705	hsa-miR-146a	CLIP-seq
MIRT1453706	hsa-miR-146b-5p	CLIP-seq
MIRT2357051	hsa-miR-184	CLIP-seq
MIRT1453707	hsa-miR-1913	CLIP-seq
MIRT2357052	hsa-miR-193a-3p	CLIP-seq
MIRT2357053	hsa-miR-193b	CLIP-seq
MIRT2357054	hsa-miR-22	CLIP-seq
MIRT2357055	hsa-miR-2467-3p	CLIP-seq
MIRT1453709	hsa-miR-2681	CLIP-seq
MIRT2357056	hsa-miR-3144-5p	CLIP-seq
MIRT2357057	hsa-miR-3187-3p	CLIP-seq
MIRT2357058	hsa-miR-3191	CLIP-seq
MIRT755621	hsa-miR-324-3p	CLIP-seq
MIRT2357059	hsa-miR-325	CLIP-seq
MIRT1453713	hsa-miR-3616-5p	CLIP-seq
MIRT1453714	hsa-miR-3647-5p	CLIP-seq
MIRT2357060	hsa-miR-3667-3p	CLIP-seq
MIRT2357061	hsa-miR-3919	CLIP-seq
MIRT2357062	hsa-miR-3925-5p	CLIP-seq
MIRT2357063	hsa-miR-4257	CLIP-seq
MIRT2357064	hsa-miR-433	CLIP-seq
MIRT1453719	hsa-miR-4488	CLIP-seq
MIRT2357065	hsa-miR-452	CLIP-seq
MIRT2357066	hsa-miR-4529-5p	CLIP-seq
MIRT2136077	hsa-miR-455-3p	CLIP-seq
MIRT1453723	hsa-miR-4635	CLIP-seq
MIRT2357067	hsa-miR-4646-3p	CLIP-seq
MIRT2357068	hsa-miR-4652-5p	CLIP-seq
MIRT2357069	hsa-miR-4676-3p	CLIP-seq
MIRT2357070	hsa-miR-4685-5p	CLIP-seq
MIRT2357071	hsa-miR-4688	CLIP-seq
MIRT1453725	hsa-miR-4697-5p	CLIP-seq
MIRT2357072	hsa-miR-4701-5p	CLIP-seq
MIRT2357073	hsa-miR-4708-3p	CLIP-seq
MIRT2357074	hsa-miR-4709-3p	CLIP-seq
MIRT2136078	hsa-miR-4719	CLIP-seq
MIRT2357075	hsa-miR-4773	CLIP-seq
MIRT1453728	hsa-miR-4795-5p	CLIP-seq
MIRT2357076	hsa-miR-486-3p	CLIP-seq
MIRT2357077	hsa-miR-500a	CLIP-seq
MIRT2357078	hsa-miR-548a-3p	CLIP-seq
MIRT2357079	hsa-miR-548e	CLIP-seq
MIRT2357080	hsa-miR-548f	CLIP-seq
MIRT2357081	hsa-miR-558	CLIP-seq
MIRT1453731	hsa-miR-573	CLIP-seq
MIRT2357082	hsa-miR-588	CLIP-seq
MIRT1453732	hsa-miR-589	CLIP-seq
MIRT2357083	hsa-miR-617	CLIP-seq
MIRT2357084	hsa-miR-628-3p	CLIP-seq
MIRT2357085	hsa-miR-640	CLIP-seq
MIRT2357086	hsa-miR-759	CLIP-seq
MIRT1453704	hsa-miR-145	CLIP-seq
MIRT2357055	hsa-miR-2467-3p	CLIP-seq
MIRT2357063	hsa-miR-4257	CLIP-seq
MIRT2357065	hsa-miR-452	CLIP-seq
MIRT2357069	hsa-miR-4676-3p	CLIP-seq
MIRT2357071	hsa-miR-4688	CLIP-seq
MIRT2357076	hsa-miR-486-3p	CLIP-seq
MIRT2650648	hsa-miR-1233	CLIP-seq
MIRT2650649	hsa-miR-1237	CLIP-seq
MIRT2650650	hsa-miR-1265	CLIP-seq
MIRT1453704	hsa-miR-145	CLIP-seq
MIRT2357051	hsa-miR-184	CLIP-seq
MIRT1453707	hsa-miR-1913	CLIP-seq
MIRT2357054	hsa-miR-22	CLIP-seq
MIRT2650651	hsa-miR-2277-3p	CLIP-seq
MIRT1453708	hsa-miR-2392	CLIP-seq
MIRT2650652	hsa-miR-3120-3p	CLIP-seq
MIRT2650653	hsa-miR-3127-3p	CLIP-seq
MIRT2357056	hsa-miR-3144-5p	CLIP-seq
MIRT2650654	hsa-miR-3151	CLIP-seq
MIRT2357057	hsa-miR-3187-3p	CLIP-seq
MIRT2650655	hsa-miR-3189-5p	CLIP-seq
MIRT2357058	hsa-miR-3191	CLIP-seq
MIRT755621	hsa-miR-324-3p	CLIP-seq
MIRT2650656	hsa-miR-345	CLIP-seq
MIRT2650657	hsa-miR-361-3p	CLIP-seq
MIRT2650658	hsa-miR-3614-3p	CLIP-seq
MIRT2650659	hsa-miR-3679-3p	CLIP-seq
MIRT2650660	hsa-miR-3714	CLIP-seq
MIRT1453716	hsa-miR-3918	CLIP-seq
MIRT2650661	hsa-miR-4256	CLIP-seq
MIRT2650662	hsa-miR-4325	CLIP-seq
MIRT2357064	hsa-miR-433	CLIP-seq
MIRT2650663	hsa-miR-4503	CLIP-seq
MIRT1453720	hsa-miR-4512	CLIP-seq
MIRT2357066	hsa-miR-4529-5p	CLIP-seq
MIRT2357068	hsa-miR-4652-5p	CLIP-seq
MIRT2650664	hsa-miR-4687-5p	CLIP-seq
MIRT2650665	hsa-miR-4694-3p	CLIP-seq
MIRT1453727	hsa-miR-4747-5p	CLIP-seq
MIRT2650666	hsa-miR-4749-3p	CLIP-seq
MIRT2650667	hsa-miR-4758-3p	CLIP-seq
MIRT2357075	hsa-miR-4773	CLIP-seq
MIRT2650668	hsa-miR-4780	CLIP-seq
MIRT1453729	hsa-miR-513b	CLIP-seq
MIRT2650669	hsa-miR-520d-5p	CLIP-seq
MIRT2650670	hsa-miR-524-5p	CLIP-seq
MIRT2650671	hsa-miR-545	CLIP-seq
MIRT2650672	hsa-miR-548an	CLIP-seq
MIRT2357081	hsa-miR-558	CLIP-seq
MIRT2357083	hsa-miR-617	CLIP-seq
MIRT2357085	hsa-miR-640	CLIP-seq
MIRT2357086	hsa-miR-759	CLIP-seq
MIRT2650648	hsa-miR-1233	CLIP-seq
MIRT2650649	hsa-miR-1237	CLIP-seq
MIRT2650650	hsa-miR-1265	CLIP-seq
MIRT1453704	hsa-miR-145	CLIP-seq
MIRT2357051	hsa-miR-184	CLIP-seq
MIRT1453707	hsa-miR-1913	CLIP-seq
MIRT2357054	hsa-miR-22	CLIP-seq
MIRT2650651	hsa-miR-2277-3p	CLIP-seq
MIRT1453708	hsa-miR-2392	CLIP-seq
MIRT2694145	hsa-miR-299-3p	CLIP-seq
MIRT2650652	hsa-miR-3120-3p	CLIP-seq
MIRT2357056	hsa-miR-3144-5p	CLIP-seq
MIRT2650654	hsa-miR-3151	CLIP-seq
MIRT2357057	hsa-miR-3187-3p	CLIP-seq
MIRT2650655	hsa-miR-3189-5p	CLIP-seq
MIRT2357058	hsa-miR-3191	CLIP-seq
MIRT755621	hsa-miR-324-3p	CLIP-seq
MIRT2650656	hsa-miR-345	CLIP-seq
MIRT2650658	hsa-miR-3614-3p	CLIP-seq
MIRT2650660	hsa-miR-3714	CLIP-seq
MIRT1453716	hsa-miR-3918	CLIP-seq
MIRT2650661	hsa-miR-4256	CLIP-seq
MIRT2357063	hsa-miR-4257	CLIP-seq
MIRT2694146	hsa-miR-4283	CLIP-seq
MIRT2650662	hsa-miR-4325	CLIP-seq
MIRT2357064	hsa-miR-433	CLIP-seq
MIRT2694147	hsa-miR-4447	CLIP-seq
MIRT2694148	hsa-miR-4472	CLIP-seq
MIRT2694149	hsa-miR-4489	CLIP-seq
MIRT2694150	hsa-miR-4491	CLIP-seq
MIRT2650663	hsa-miR-4503	CLIP-seq
MIRT1453720	hsa-miR-4512	CLIP-seq
MIRT2694151	hsa-miR-4528	CLIP-seq
MIRT2357066	hsa-miR-4529-5p	CLIP-seq
MIRT2357068	hsa-miR-4652-5p	CLIP-seq
MIRT2694152	hsa-miR-4656	CLIP-seq
MIRT2694153	hsa-miR-4657	CLIP-seq
MIRT2650664	hsa-miR-4687-5p	CLIP-seq
MIRT2650666	hsa-miR-4749-3p	CLIP-seq
MIRT2650667	hsa-miR-4758-3p	CLIP-seq
MIRT2357075	hsa-miR-4773	CLIP-seq
MIRT2650668	hsa-miR-4780	CLIP-seq
MIRT2694154	hsa-miR-491-5p	CLIP-seq
MIRT2650669	hsa-miR-520d-5p	CLIP-seq
MIRT2650670	hsa-miR-524-5p	CLIP-seq
MIRT2650671	hsa-miR-545	CLIP-seq
MIRT2650672	hsa-miR-548an	CLIP-seq
MIRT2357081	hsa-miR-558	CLIP-seq
MIRT2357083	hsa-miR-617	CLIP-seq
MIRT2357085	hsa-miR-640	CLIP-seq
MIRT2357086	hsa-miR-759	CLIP-seq

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10976108
GO:0000209	Process	Protein polyubiquitination	IBA	21873635
GO:0001650	Component	Fibrillar center	IDA
GO:0002820	Process	Negative regulation of adaptive immune response	IMP	22128329
GO:0003676	Function	Nucleic acid binding	TAS	3380101
GO:0003677	Function	DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	22128329
GO:0004842	Function	Ubiquitin-protein transferase activity	IMP	23452853
GO:0005515	Function	Protein binding	IPI	9570750, 10504338, 15837424, 16189514, 21516116, 22128329, 22829933, 23452853, 24722188, 25416956, 25910212, 26871637, 27107012, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17156811
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA	10976108
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	17156811
GO:0005768	Component	Endosome	IDA	23452853
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	22128329
GO:0007283	Process	Spermatogenesis	TAS	3380101
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA	21873635
GO:0010508	Process	Positive regulation of autophagy	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016605	Component	PML body	IEA
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0030904	Component	Retromer complex	IDA	23452853
GO:0031965	Component	Nuclear membrane	IDA	10976108
GO:0032609	Process	Interferon-gamma production	IMP	22128329
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	22128329
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	22128329
GO:0032880	Process	Regulation of protein localization	IBA	21873635
GO:0032897	Process	Negative regulation of viral transcription	IBA	21873635
GO:0032897	Process	Negative regulation of viral transcription	IDA	18248090
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IDA	23452853
GO:0042147	Process	Retrograde transport, endosome to Golgi	IDA	23452853
GO:0042802	Function	Identical protein binding	IPI	17156811, 22829933, 25416956, 27107012
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IDA	10976108
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046596	Process	Regulation of viral entry into host cell	IBA	21873635
GO:0046872	Function	Metal ion binding	TAS	3380101
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	23077300
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	EXP	23419514
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0070534	Process	Protein K63-linked ubiquitination	IBA	21873635
GO:0070534	Process	Protein K63-linked ubiquitination	IMP	23452853
GO:0090281	Process	Negative regulation of calcium ion import	IMP	22128329

MIM	HGNC	e!Ensembl
602165	9975	ENSG00000204713

Protein

UniProt ID

P14373

Protein name

Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (Ret finger protein) (Tripartite motif-containing protein 27)

Protein function

E3 ubiquitin-protein ligase that mediates ubiquitination of various substrates and thereby plays a role in diffent processes including proliferation, innate immunity, apoptosis, immune response or autophagy (PubMed:22829933, PubMed:24144979, Pub

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	16 → 56		Domain
PF00643	zf-B_box	91 → 132	B-box zinc finger	Domain
PF13765	PRY	318 → 366	SPRY-associated domain	Family
PF00622	SPRY	370 → 487	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis namely within the seminiferous tubules. {ECO:0000269|PubMed:12445133}.

Sequence

MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP

Sequence length

513

Interactions

View interactions

	Reactome
			SUMOylation of ubiquitinylation proteins Regulation of PTEN stability and activity Suppression of apoptosis

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Papillary thyroid carcinoma	Papillary thyroid carcinoma	rs751409106	12787916, 17062879
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	30285260

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Psoriasis	Psoriasis	GWAS
Hyperthyroidism	Hyperthyroidism	GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	26356813
Adenoma Pleomorphic	Associate	34985683
Albuminuria	Associate	37872228
Breast Neoplasms	Associate	37307465
Carcinogenesis	Associate	39266987, 9599022
Carcinoma Hepatocellular	Associate	36217828
Carcinoma Intraductal Noninfiltrating	Associate	30610524, 31162284, 34985683
Carcinoma Non Small Cell Lung	Associate	33264103, 33448640, 34932879
Carcinoma Ovarian Epithelial	Associate	23011823
Carcinoma Renal Cell	Associate	33173411
Colorectal Neoplasms	Associate	39266987
Cytomegalovirus Infections	Associate	33446692
Diabetic Nephropathies	Associate	36627639
Endometrial Neoplasms	Associate	19650860, 23011823, 39394602
Esophageal Squamous Cell Carcinoma	Associate	24595008
Glioma	Associate	35986882
Hematuria	Associate	37872228
Infertility Male	Associate	31103287
Leukemia Biphenotypic Acute	Associate	32661669
Lung Neoplasms	Associate	33448640
Lymphatic Metastasis	Associate	34985683
Melanoma	Associate	33118318
Neoplasm Invasiveness	Associate	31162284, 34985683
Neoplasm Metastasis	Associate	23135352, 33264103, 34985683, 36217828, 39266987
Neoplasms	Associate	19650860, 23011823, 23791107, 30610524, 31162284, 33264103, 36217828, 36380570, 36579638
Neoplasms	Stimulate	23135352
Neoplasms Cystic Mucinous and Serous	Associate	23011823
Neoplasms Cystic Mucinous and Serous	Stimulate	28155970
Ovarian Neoplasms	Associate	23791107, 36722270, 36978087
Prostatic Neoplasms	Associate	23135352, 32366400
Salivary Gland Neoplasms	Associate	30610524
Schaaf Yang syndrome	Associate	34128869
Stomach Neoplasms	Associate	36380570
Tetralogy of Fallot	Associate	30977211
Thyroid Neoplasms	Associate	32737449
Vitamin D Deficiency	Associate	23527013

TRIM27 (tripartite motif containing 27)