Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5965
Gene name Gene Name - the full gene name approved by the HGNC.	RecQ like helicase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RECQL
Synonyms (NCBI Gene) Gene synonyms aliases	RECON, RECQL1, RecQ1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	RECON
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p12.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the RecQ DNA helicase family. DNA helicases are enzymes involved in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. The encoded protein is involved in th

Show/Hide all(15)

SNP ID	Visualize variation	Clinical significance	Consequence
rs376037221	A>C	Likely-pathogenic	Stop gained, coding sequence variant
rs572725483	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs745659712	T>-,TT	Pathogenic	Coding sequence variant, frameshift variant
rs753723230	A>-	Likely-pathogenic, pathogenic	Frameshift variant, coding sequence variant
rs768075076	ACAA>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs770499904	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs772102674	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1010112210	C>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1473421036	GA>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1565569139	G>ACATGCTACATC	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1565570957	GAACT>-	Likely-pathogenic	Stop gained, coding sequence variant
rs1591973610	T>C	Likely-pathogenic	Splice acceptor variant
rs1591981379	->ACAT	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1591981391	->CTACATC	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1591988737	GGAAAATCTAGGAAAAGAAAGTTAAGAAT>-	Likely-pathogenic	Intron variant, splice acceptor variant, coding sequence variant

Show/Hide all(105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024543	hsa-miR-215-5p	Microarray	19074876
MIRT024543	hsa-miR-215-5p	Microarray	19074876
MIRT026858	hsa-miR-192-5p	Microarray	19074876
MIRT030018	hsa-miR-26b-5p	Microarray	19088304
MIRT049712	hsa-miR-92a-3p	CLASH	23622248
MIRT439791	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT439791	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT1299250	hsa-miR-1266	CLIP-seq
MIRT1299251	hsa-miR-223	CLIP-seq
MIRT1299252	hsa-miR-24	CLIP-seq
MIRT1299253	hsa-miR-3136-3p	CLIP-seq
MIRT1299254	hsa-miR-34c-3p	CLIP-seq
MIRT1299255	hsa-miR-369-3p	CLIP-seq
MIRT1299256	hsa-miR-374a	CLIP-seq
MIRT1299257	hsa-miR-374b	CLIP-seq
MIRT1299258	hsa-miR-4270	CLIP-seq
MIRT1299259	hsa-miR-4276	CLIP-seq
MIRT1299260	hsa-miR-4284	CLIP-seq
MIRT1299261	hsa-miR-4441	CLIP-seq
MIRT1299262	hsa-miR-4474-3p	CLIP-seq
MIRT1299263	hsa-miR-4518	CLIP-seq
MIRT1299264	hsa-miR-4659a-3p	CLIP-seq
MIRT1299265	hsa-miR-4659b-3p	CLIP-seq
MIRT1299266	hsa-miR-4697-3p	CLIP-seq
MIRT1299267	hsa-miR-4778-3p	CLIP-seq
MIRT1299268	hsa-miR-4786-3p	CLIP-seq
MIRT1299269	hsa-miR-548a-5p	CLIP-seq
MIRT1299270	hsa-miR-548ab	CLIP-seq
MIRT1299271	hsa-miR-548ak	CLIP-seq
MIRT1299272	hsa-miR-548b-5p	CLIP-seq
MIRT1299273	hsa-miR-548c-5p	CLIP-seq
MIRT1299274	hsa-miR-548d-5p	CLIP-seq
MIRT1299275	hsa-miR-548h	CLIP-seq
MIRT1299276	hsa-miR-548i	CLIP-seq
MIRT1299277	hsa-miR-548j	CLIP-seq
MIRT1299278	hsa-miR-548k	CLIP-seq
MIRT1299279	hsa-miR-548l	CLIP-seq
MIRT1299280	hsa-miR-548w	CLIP-seq
MIRT1299281	hsa-miR-548y	CLIP-seq
MIRT1299282	hsa-miR-559	CLIP-seq
MIRT1299283	hsa-miR-671-5p	CLIP-seq
MIRT1553072	hsa-miR-607	CLIP-seq
MIRT1299250	hsa-miR-1266	CLIP-seq
MIRT1299252	hsa-miR-24	CLIP-seq
MIRT1299258	hsa-miR-4270	CLIP-seq
MIRT1299260	hsa-miR-4284	CLIP-seq
MIRT1299261	hsa-miR-4441	CLIP-seq
MIRT1299262	hsa-miR-4474-3p	CLIP-seq
MIRT1299263	hsa-miR-4518	CLIP-seq
MIRT2089069	hsa-miR-4690-3p	CLIP-seq
MIRT2089070	hsa-miR-4719	CLIP-seq
MIRT2089071	hsa-miR-4762-5p	CLIP-seq
MIRT1299268	hsa-miR-4786-3p	CLIP-seq
MIRT1299283	hsa-miR-671-5p	CLIP-seq
MIRT1299250	hsa-miR-1266	CLIP-seq
MIRT1299252	hsa-miR-24	CLIP-seq
MIRT1299258	hsa-miR-4270	CLIP-seq
MIRT1299260	hsa-miR-4284	CLIP-seq
MIRT1299261	hsa-miR-4441	CLIP-seq
MIRT1299262	hsa-miR-4474-3p	CLIP-seq
MIRT1299263	hsa-miR-4518	CLIP-seq
MIRT1299268	hsa-miR-4786-3p	CLIP-seq
MIRT2313898	hsa-miR-561	CLIP-seq
MIRT1299283	hsa-miR-671-5p	CLIP-seq
MIRT1299253	hsa-miR-3136-3p	CLIP-seq
MIRT1299262	hsa-miR-4474-3p	CLIP-seq
MIRT1299264	hsa-miR-4659a-3p	CLIP-seq
MIRT1299265	hsa-miR-4659b-3p	CLIP-seq
MIRT1299267	hsa-miR-4778-3p	CLIP-seq
MIRT2610479	hsa-miR-1251	CLIP-seq
MIRT2610480	hsa-miR-1283	CLIP-seq
MIRT2610481	hsa-miR-129-5p	CLIP-seq
MIRT2610482	hsa-miR-219-2-3p	CLIP-seq
MIRT2610483	hsa-miR-2964a-3p	CLIP-seq
MIRT2610484	hsa-miR-331-5p	CLIP-seq
MIRT2610485	hsa-miR-3682-5p	CLIP-seq
MIRT2610486	hsa-miR-4307	CLIP-seq
MIRT2610487	hsa-miR-4452	CLIP-seq
MIRT2610488	hsa-miR-4652-3p	CLIP-seq
MIRT2610489	hsa-miR-4662a-5p	CLIP-seq
MIRT2089069	hsa-miR-4690-3p	CLIP-seq
MIRT2610490	hsa-miR-4773	CLIP-seq
MIRT2610491	hsa-miR-4803	CLIP-seq
MIRT2610492	hsa-miR-490-3p	CLIP-seq
MIRT2610493	hsa-miR-548c-3p	CLIP-seq
MIRT2610494	hsa-miR-577	CLIP-seq
MIRT2610495	hsa-miR-618	CLIP-seq
MIRT2610496	hsa-miR-649	CLIP-seq
MIRT2610497	hsa-miR-653	CLIP-seq
MIRT2610479	hsa-miR-1251	CLIP-seq
MIRT2610480	hsa-miR-1283	CLIP-seq
MIRT2610481	hsa-miR-129-5p	CLIP-seq
MIRT2610482	hsa-miR-219-2-3p	CLIP-seq
MIRT2610483	hsa-miR-2964a-3p	CLIP-seq
MIRT2610485	hsa-miR-3682-5p	CLIP-seq
MIRT2610486	hsa-miR-4307	CLIP-seq
MIRT2610487	hsa-miR-4452	CLIP-seq
MIRT2610488	hsa-miR-4652-3p	CLIP-seq
MIRT2089069	hsa-miR-4690-3p	CLIP-seq
MIRT2610490	hsa-miR-4773	CLIP-seq
MIRT2610491	hsa-miR-4803	CLIP-seq
MIRT2610492	hsa-miR-490-3p	CLIP-seq
MIRT2610495	hsa-miR-618	CLIP-seq
MIRT2610496	hsa-miR-649	CLIP-seq
MIRT2610497	hsa-miR-653	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	IBA	21873635
GO:0000733	Process	DNA strand renaturation	IDA	19177149
GO:0003677	Function	DNA binding	IEA
GO:0003678	Function	DNA helicase activity	IDA	11562355
GO:0005515	Function	Protein binding	IPI	9168958, 15886194, 23396353
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	TAS	7961977
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0006268	Process	DNA unwinding involved in DNA replication	IBA	21873635
GO:0006281	Process	DNA repair	IBA	21873635
GO:0006310	Process	DNA recombination	IBA	21873635
GO:0009378	Function	Four-way junction helicase activity	IBA	21873635
GO:0016020	Component	Membrane	HDA	19946888
GO:0032508	Process	DNA duplex unwinding	IBA	21873635
GO:0036310	Function	Annealing helicase activity	IBA	21873635
GO:0036310	Function	Annealing helicase activity	IDA	19177149
GO:0043138	Function	3'-5' DNA helicase activity	IBA	21873635

MIM	HGNC	e!Ensembl
600537	9948	ENSG00000004700

Protein

UniProt ID

P46063

Protein name

ATP-dependent DNA helicase Q1 (EC 5.6.2.4) (DNA 3'-5' helicase Q1) (DNA helicase, RecQ-like type 1) (RecQ1) (DNA-dependent ATPase Q1) (RecQ protein-like 1)

Protein function

DNA helicase that plays a role in DNA damage repair and genome stability (PubMed:15886194, PubMed:35025765, PubMed:7527136, PubMed:7961977, PubMed:8056767). Exhibits a Mg(2+)- and ATP-dependent DNA-helicase activity that unwinds single- and doub

PDB

2V1X , 2WWY , 4U7D , 6JTZ , 8YRS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00270	DEAD	93 → 264	DEAD/DEAH box helicase	Domain
PF00271	Helicase_C	299 → 409	Helicase conserved C-terminal domain	Family
PF16124	RecQ_Zn_bind	420 → 479	RecQ zinc-binding	Domain

Tissue specificity

TISSUE SPECIFICITY: High expression in heart, lung, skeletal muscle and kidney, low expression in brain. {ECO:0000269|PubMed:7961977}.

Sequence

MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNE
YDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKS
LCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNK
NSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGI
LKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDF
IEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKW
SANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGF
GDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCK
DSAFERKNITEYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPRE
DLEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRA
ESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDDA

Sequence length

649

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast, Breast Cancer, Familial	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	25915596, 17158923, 25945795, 18074021, 15886194
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	25915596
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	25915596

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Breast Cancer	breast cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GenCC, CBGDA
Ovarian cancer	familial ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth	GenCC, CBGDA
Breast Carcinoma	hereditary breast carcinoma		GenCC

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	32221746
Aging Premature	Associate	23650516
Bloom Syndrome	Associate	11154689, 11309417, 15899892, 16595695, 20826342, 23650516, 24958861, 30936263, 32221746
Breast Neoplasms	Associate	25394896, 25483193, 25945795, 26125302, 26455304, 27248010, 27837030, 29351780, 29914420, 31444271, 32427313, 33468559, 34461861, 35231585, 35965009, 38134458 View all (1 more)
Carcinoma Intraductal Noninfiltrating	Associate	38134458
Carcinoma Ovarian Epithelial	Associate	25424877
Carcinoma Squamous Cell	Associate	24854846
Cutis Laxa Autosomal Recessive Type IIB	Associate	35025765
Drug Related Side Effects and Adverse Reactions	Associate	25228686, 28186131
Genomic Instability	Associate	35025765
Growth Disorders	Associate	35025765
Hereditary Breast and Ovarian Cancer Syndrome	Associate	29351780
Ichthyosis	Associate	35025765
Immunologic Deficiency Syndromes	Associate	27102625, 27859906
Laryngeal Neoplasms	Associate	24213927
Leukopenia	Associate	22031394
Multiple Myeloma	Associate	28186131
Neoplasm Metastasis	Associate	25483193
Neoplasms	Associate	17953710, 23650516, 23951333, 24213927, 24287950, 24854846, 25424877, 25483193, 26125302, 26455304, 27102625, 27248010, 27837030, 33468559, 35231585, 38134458 View all (1 more)
Nose Diseases	Associate	35025765
Osteosarcoma	Associate	24287950, 25867335
Ovarian Neoplasms	Associate	23951333
Pancreatic Neoplasms	Associate	16520463, 16540687, 26725729
Precancerous Conditions	Associate	25228686
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	39495115
Prodromal Symptoms	Associate	25424877
Rothmund Thomson Syndrome	Associate	23650516
Sick Sinus Syndrome	Associate	26725729
Squamous Cell Carcinoma of Head and Neck	Associate	24854846
Syndrome	Associate	35025765
Triple Negative Breast Neoplasms	Associate	31444271
Werner Syndrome	Associate	15899892, 23650516, 25228686

RECQL (RecQ like helicase)