Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5965
Gene name Gene Name - the full gene name approved by the HGNC.
RecQ like helicase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RECQL
Synonyms (NCBI Gene) Gene synonyms aliases
RECON, RECQL1, RecQ1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the RecQ DNA helicase family. DNA helicases are enzymes involved in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. The encoded protein is involved in th
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs376037221 A>C Likely-pathogenic Stop gained, coding sequence variant
rs572725483 G>A Likely-pathogenic Coding sequence variant, stop gained
rs745659712 T>-,TT Pathogenic Coding sequence variant, frameshift variant
rs753723230 A>- Likely-pathogenic, pathogenic Frameshift variant, coding sequence variant
rs768075076 ACAA>- Likely-pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024543 hsa-miR-215-5p Microarray 19074876
MIRT024543 hsa-miR-215-5p Microarray 19074876
MIRT026858 hsa-miR-192-5p Microarray 19074876
MIRT030018 hsa-miR-26b-5p Microarray 19088304
MIRT049712 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003678 Function DNA helicase activity IDA 11562355
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600537 9948 ENSG00000004700
Protein
UniProt ID P46063
Protein name ATP-dependent DNA helicase Q1 (EC 5.6.2.4) (DNA 3'-5' helicase Q1) (DNA helicase, RecQ-like type 1) (RecQ1) (DNA-dependent ATPase Q1) (RecQ protein-like 1)
Protein function DNA helicase that plays a role in DNA damage repair and genome stability (PubMed:15886194, PubMed:35025765, PubMed:7527136, PubMed:7961977, PubMed:8056767). Exhibits a Mg(2+)- and ATP-dependent DNA-helicase activity that unwinds single- and doub
PDB 2V1X , 2WWY , 4U7D , 6JTZ , 8YRS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00270 DEAD 93 264 DEAD/DEAH box helicase Domain
PF00271 Helicase_C 299 409 Helicase conserved C-terminal domain Family
PF16124 RecQ_Zn_bind 420 479 RecQ zinc-binding Domain
Tissue specificity TISSUE SPECIFICITY: High expression in heart, lung, skeletal muscle and kidney, low expression in brain. {ECO:0000269|PubMed:7961977}.
Sequence
MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNE
YDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKS
LCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNK
NSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGI
LKRQFPNASLIGLTATATNHVLTD
AQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDF
IEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKW
SANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDD
MKADCILYYGF
GDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCC
K
DSAFERKNITEYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPRE
DLEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRA
ESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDDA
Sequence length 649
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer breast cancer N/A N/A GenCC
Breast Carcinoma hereditary breast carcinoma N/A N/A GenCC
hereditary cancer Hereditary cancer N/A N/A ClinVar
Ovarian cancer familial ovarian cancer N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32221746
Aging Premature Associate 23650516
Bloom Syndrome Associate 11154689, 11309417, 15899892, 16595695, 20826342, 23650516, 24958861, 30936263, 32221746
Breast Neoplasms Associate 25394896, 25483193, 25945795, 26125302, 26455304, 27248010, 27837030, 29351780, 29914420, 31444271, 32427313, 33468559, 34461861, 35231585, 35965009
View all (1 more)
Carcinoma Intraductal Noninfiltrating Associate 38134458
Carcinoma Ovarian Epithelial Associate 25424877
Carcinoma Squamous Cell Associate 24854846
Cutis Laxa Autosomal Recessive Type IIB Associate 35025765
Drug Related Side Effects and Adverse Reactions Associate 25228686, 28186131
Genomic Instability Associate 35025765