RBMY1A1 (RNA binding motif protein Y-linked family 1 member A1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 5940
Gene name RNA binding motif protein Y-linked family 1 member A1
Gene symbol RBMY1A1
Synonyms (NCBI Gene)
RBMRBM1RBM2RBMYRBMY1CYRRM1YRRM2
Chromosome Y
Chromosome location Yq11.223
Summary This gene encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. This protein is thought to function as a splicing regulator during spermatogenesis. Multiple closely
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT644779 hsa-miR-3121-5p HITS-CLIP 23824327
MIRT644778 hsa-miR-570-3p HITS-CLIP 23824327
MIRT644777 hsa-miR-5585-3p HITS-CLIP 23824327
MIRT644779 hsa-miR-3121-5p HITS-CLIP 23824327
MIRT644778 hsa-miR-570-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (13)
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IDA 12165565
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IDA 12165565
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
400006 9912 ENSG00000234414
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DJD3
Protein name RNA-binding motif protein, Y chromosome, family 1 member A1 (RNA-binding motif protein 1) (RNA-binding motif protein 2) (Y chromosome RNA recognition motif 1) (hRBMY)
Protein function RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs. {ECO:0000269|PubMed:12165565, ECO:000026
PDB 2FY1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 10 → 79 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF08081 RBM1CTR 174 → 218 RBM1CTR (NUC064) family Family
Tissue specificity TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:8269511}.
Sequence 
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASI
VDGGESRSEKGDSSRY
Sequence length 496
Interactions View interactions