LGR6 (leucine rich repeat containing G protein-coupled receptor 6)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
59352
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat containing G protein-coupled receptor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LGR6
Synonyms (NCBI Gene) Gene synonyms aliases
GPCR, VTS20631
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leuci
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
miRTarBase ID miRNA Experiments Reference
MIRT017776 hsa-miR-335-5p Microarray 18185580
MIRT1108573 hsa-miR-1253 CLIP-seq
MIRT1108574 hsa-miR-3150a-3p CLIP-seq
MIRT1108575 hsa-miR-3175 CLIP-seq
MIRT1108576 hsa-miR-4728-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(24)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity ISS
GO:0004930 Function G protein-coupled receptor activity ISS
GO:0005515 Function Protein binding IPI 21727895, 22615920
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606653 19719 ENSG00000133067
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9HBX8
Protein name Leucine-rich repeat-containing G-protein coupled receptor 6
Protein function Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and friz
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 90 → 150 Leucine rich repeat Repeat
PF13855 LRR_8 138 → 198 Leucine rich repeat Repeat
PF13855 LRR_8 188 → 246 Leucine rich repeat Repeat
PF13306 LRR_5 254 → 368 BspA type Leucine rich repeat region (6 copies) Repeat
PF13855 LRR_8 328 → 386 Leucine rich repeat Repeat
PF13855 LRR_8 374 → 434 Leucine rich repeat Repeat
Sequence 
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAV
PGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILM
LQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLD
LNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELS
HNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
PYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPH
PSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFV
VGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLL
TLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT
LISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSG
LAFASHV
Sequence length 967
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Wnt signaling pathway   Regulation of FZD by ubiquitination
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Breast cancer (estrogen-receptor negative), Breast cancer N/A N/A GWAS
Breast Cancer Breast cancer subtype (HER2-enriched-like vs luminal A-like), Breast cancer subtype (triple negative vs luminal A-like) N/A N/A GWAS
Stress Disorder Post-traumatic stress disorder N/A N/A GWAS
Show/Hide Text Mining Associations (31)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35441736
Adenocarcinoma of Lung Stimulate 38014454
Anonychia congenita Associate 23809763
Breast Carcinoma In Situ Associate 24743323
Breast Neoplasms Associate 24743323
Carcinoma Large Cell Stimulate 38014454
Carcinoma Non Small Cell Lung Stimulate 38014454
Carcinoma Pancreatic Ductal Associate 37770230
Cardiomyopathy Restrictive Associate 24194869
Colorectal Neoplasms Associate 22615920, 33034614