LGR6 (leucine rich repeat containing G protein-coupled receptor 6)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 59352
Gene name Leucine rich repeat containing G protein-coupled receptor 6
Gene symbol LGR6
Synonyms (NCBI Gene)
GPCRVTS20631
Chromosome 1
Chromosome location 1q32.1
Summary This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leuci
miRNA miRNA information provided by mirtarbase database.
8
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (8)
miRTarBase ID miRNA Experiments Reference
MIRT017776 hsa-miR-335-5p Microarray 18185580
MIRT1108573 hsa-miR-1253 CLIP-seq
MIRT1108574 hsa-miR-3150a-3p CLIP-seq
MIRT1108575 hsa-miR-3175 CLIP-seq
MIRT1108576 hsa-miR-4728-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (24)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity ISS
GO:0004930 Function G protein-coupled receptor activity ISS
GO:0005515 Function Protein binding IPI 21727895, 22615920
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606653 19719 ENSG00000133067
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HBX8
Protein name Leucine-rich repeat-containing G-protein coupled receptor 6
Protein function Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and friz
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 90 → 150 Leucine rich repeat Repeat
PF13855 LRR_8 138 → 198 Leucine rich repeat Repeat
PF13855 LRR_8 188 → 246 Leucine rich repeat Repeat
PF13306 LRR_5 254 → 368 BspA type Leucine rich repeat region (6 copies) Repeat
PF13855 LRR_8 328 → 386 Leucine rich repeat Repeat
PF13855 LRR_8 374 → 434 Leucine rich repeat Repeat
Sequence 
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAV
PGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILM
LQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLD
LNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELS
HNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
PYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPH
PSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFV
VGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLL
TLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT
LISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSG
LAFASHV
Sequence length 967
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Wnt signaling pathway   Regulation of FZD by ubiquitination
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial pancreatic carcinoma Benign rs146771876 RCV005909860
Malignant tumor of esophagus Benign rs146771876 RCV005909858
Ovarian cancer Benign rs146771876 RCV005909859
Ovarian serous cystadenocarcinoma Benign rs146771876 RCV005909861
Show/Hide Text Mining Associations (31)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35441736
Adenocarcinoma of Lung Stimulate 38014454
Anonychia congenita Associate 23809763
Breast Carcinoma In Situ Associate 24743323
Breast Neoplasms Associate 24743323
Carcinoma Large Cell Stimulate 38014454
Carcinoma Non Small Cell Lung Stimulate 38014454
Carcinoma Pancreatic Ductal Associate 37770230
Cardiomyopathy Restrictive Associate 24194869
Colorectal Neoplasms Associate 22615920, 33034614