Gene Gene information from NCBI Gene database.
Entrez ID 5935
Gene name RNA binding motif protein 3
Gene symbol RBM3
Synonyms (NCBI Gene)
IS1-RNPLRNPL
Chromosome X
Chromosome location Xp11.23
Summary This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple
miRNA miRNA information provided by mirtarbase database.
1038
miRTarBase ID miRNA Experiments Reference
MIRT029488 hsa-miR-26b-5p Microarray 19088304
MIRT047926 hsa-miR-30c-5p CLASH 23622248
MIRT622505 hsa-miR-224-5p HITS-CLIP 19536157
MIRT625776 hsa-miR-3691-3p HITS-CLIP 19536157
MIRT625775 hsa-miR-6814-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
GO:0003723 Function RNA binding TAS 8634703
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300027 9900 ENSG00000102317
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P98179
Protein name RNA-binding protein 3 (RNA-binding motif protein 3) (RNPL)
Protein function Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiati
PDB 7EB1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 8 78 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHA
SVAMRAMNGESLDGRQIR
VDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDS
RPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Sequence length 157
Interactions View interactions