Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5935
Gene name Gene Name - the full gene name approved by the HGNC.
RNA binding motif protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBM3
Synonyms (NCBI Gene) Gene synonyms aliases
IS1-RNPL, RNPL
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029488 hsa-miR-26b-5p Microarray 19088304
MIRT047926 hsa-miR-30c-5p CLASH 23622248
MIRT622505 hsa-miR-224-5p HITS-CLIP 19536157
MIRT625776 hsa-miR-3691-3p HITS-CLIP 19536157
MIRT625775 hsa-miR-6814-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 15518812, 25416956, 29892012, 31515488, 32296183
GO:0005634 Component Nucleus ISS
GO:0005654 Component Nucleoplasm IDA
GO:0005681 Component Spliceosomal complex IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300027 9900 ENSG00000102317
Protein
UniProt ID P98179
Protein name RNA-binding protein 3 (RNA-binding motif protein 3) (RNPL)
Protein function Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiati
PDB 7EB1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 8 78 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHA
SVAMRAMNGESLDGRQIR
VDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDS
RPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Sequence length 157
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
19734850
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
19734850
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
19734850
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32491279
Anodontia Associate 26577765
Bohring syndrome Associate 33141183
Breast Neoplasms Associate 19734850, 20727170, 21777469, 21955582, 29263314
Calcinosis Cutis Associate 25811459
Carcinogenesis Associate 22145045, 26577765
Carcinoma Hepatocellular Associate 31235426, 36419260, 37301543
Carcinoma Non Small Cell Lung Associate 32491279
Carcinoma Ovarian Epithelial Associate 20727170
Colorectal Neoplasms Associate 19734850, 21955582, 26331352, 28800641, 37286944