Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5893
Gene name Gene Name - the full gene name approved by the HGNC.
RAD52 DNA repair protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RAD52
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000156 hsa-miR-210-3p immunoprecipitaion, qRT-PCR 19826008
MIRT000156 hsa-miR-210-3p Luciferase reporter assay, qRT-PCR, Western blot 19141645
MIRT000156 hsa-miR-210-3p Luciferase reporter assay, qRT-PCR, Western blot 19141645
MIRT003914 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 19141645
MIRT717823 hsa-miR-3671 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0000724 Process Double-strand break repair via homologous recombination IEA
GO:0000724 Process Double-strand break repair via homologous recombination IEA
GO:0000730 Process DNA recombinase assembly IEA
GO:0003677 Function DNA binding IDA 19506022
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600392 9824 ENSG00000002016
Protein
UniProt ID P43351
Protein name DNA repair protein RAD52 homolog
Protein function Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase. {ECO:0000269|PubMed:12379650, ECO
PDB 1H2I , 1KN0 , 5JRB , 5XRZ , 5XS0 , 8BJM , 8H1P , 8RIL , 8RJ3 , 8RJW , 8TKQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04098 Rad52_Rad22 35 183 Rad52/22 family double-strand break repair protein Family
Sequence
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLP
LEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Sequence length 418
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Homologous recombination   SUMOylation of DNA damage response and repair proteins
HDR through Single Strand Annealing (SSA)
<