Gene Gene information from NCBI Gene database.
Entrez ID 5893
Gene name RAD52 DNA repair protein
Gene symbol RAD52
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12p13.33
Summary The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-
miRNA miRNA information provided by mirtarbase database.
200
miRTarBase ID miRNA Experiments Reference
MIRT000156 hsa-miR-210-3p immunoprecipitaionqRT-PCR 19826008
MIRT000156 hsa-miR-210-3p Luciferase reporter assayqRT-PCRWestern blot 19141645
MIRT000156 hsa-miR-210-3p Luciferase reporter assayqRT-PCRWestern blot 19141645
MIRT003914 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 19141645
MIRT717823 hsa-miR-3671 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0000724 Process Double-strand break repair via homologous recombination IEA
GO:0000724 Process Double-strand break repair via homologous recombination IEA
GO:0000730 Process DNA recombinase assembly IEA
GO:0003677 Function DNA binding IDA 19506022
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600392 9824 ENSG00000002016
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P43351
Protein name DNA repair protein RAD52 homolog
Protein function Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase. {ECO:0000269|PubMed:12379650, ECO
PDB 1H2I , 1KN0 , 5JRB , 5XRZ , 5XS0 , 8BJM , 8H1P , 8RIL , 8RJ3 , 8RJW , 8TKQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04098 Rad52_Rad22 35 183 Rad52/22 family double-strand break repair protein Family
Sequence
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLP
LEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Sequence length 418
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Homologous recombination   SUMOylation of DNA damage response and repair proteins
HDR through Single Strand Annealing (SSA)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital myasthenic syndrome 19 Benign rs4987207 RCV005861361
RAD52-related disorder Benign rs4987207 RCV003914277
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 29667179
Breast Diseases Associate 33275133
Breast Neoplasms Associate 10507777, 21148102, 26548611, 26873923, 36107942, 37445737, 37578974
Carcinoma Mucoepidermoid Associate 26035306
Carcinoma Non Small Cell Lung Associate 32401173
Carcinoma Squamous Cell Associate 25793373, 29924316, 32401173
Chromosomal Instability Associate 22279048
Chromosome Aberrations Associate 21148102
Chromosome Breakage Associate 15929725
Colorectal Neoplasms Inhibit 17109495