Gene Gene information from NCBI Gene database.
Entrez ID 5886
Gene name RAD23 nucleotide excision repair protein A
Gene symbol RAD23A
Synonyms (NCBI Gene)
HHR23AHR23A
Chromosome 19
Chromosome location 19p13.13
Summary The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair. Proteins in this family have a modular domain structure consisting of an ubiquitin-like domain (UbL), ubiqui
miRNA miRNA information provided by mirtarbase database.
190
miRTarBase ID miRNA Experiments Reference
MIRT044607 hsa-miR-320a CLASH 23622248
MIRT042965 hsa-miR-324-3p CLASH 23622248
MIRT040146 hsa-miR-615-3p CLASH 23622248
MIRT037882 hsa-miR-455-3p CLASH 23622248
MIRT1287710 hsa-miR-1266 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IEA
GO:0003684 Function Damaged DNA binding IEA
GO:0003697 Function Single-stranded DNA binding IEA
GO:0003697 Function Single-stranded DNA binding TAS 8168482
GO:0005515 Function Protein binding IPI 10488153, 16189514, 16712842, 16713569, 16990800, 17098253, 20059542, 22575648, 25416956, 29997244, 30455355, 30659753, 31467278, 31515488, 32296183, 32814053, 33961781, 37398436
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600061 9812 ENSG00000179262
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P54725
Protein name UV excision repair protein RAD23 homolog A (HR23A) (hHR23A)
Protein function Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable
PDB 1DV0 , 1F4I , 1IFY , 1OQY , 1P98 , 1P9D , 1QZE , 1TP4 , 2WYQ , 5XBO , 6W2G , 6W2H , 6W2I , 6XQI , 6XQJ , 7TGP , 8Q06
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00240 ubiquitin 5 79 Ubiquitin family Domain
PF00627 UBA 162 198 UBA/TS-N domain Domain
PF09280 XPC-binding 232 288 XPC-binding domain Domain
PF00627 UBA 319 355 UBA/TS-N domain Domain
Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKT
KAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYL
LTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPP
GELADISDVEGE
VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
DDE
Sequence length 363
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Nucleotide excision repair
Protein processing in endoplasmic reticulum
  Josephin domain DUBs
DNA Damage Recognition in GG-NER
Formation of Incision Complex in GG-NER