Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
585
Gene name Gene Name - the full gene name approved by the HGNC.
Bardet-Biedl syndrome 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BBS4
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and cognitive disability. The proteins
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs2277596 A>G,T Conflicting-interpretations-of-pathogenicity, likely-benign Missense variant, non coding transcript variant, coding sequence variant
rs28938468 C>A,G Pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs75295839 A>C,G Likely-benign, benign-likely-benign, conflicting-interpretations-of-pathogenicity Non coding transcript variant, 5 prime UTR variant, missense variant, coding sequence variant
rs113994189 A>- Pathogenic Intron variant
rs113994190 G>A,C Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT441121 hsa-miR-382-5p HITS-CLIP 24374217
MIRT441119 hsa-miR-432-5p HITS-CLIP 24374217
MIRT441118 hsa-miR-127-5p HITS-CLIP 24374217
MIRT441117 hsa-miR-377-3p HITS-CLIP 24374217
MIRT441116 hsa-miR-376c-3p HITS-CLIP 24374217
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization ISS
GO:0000242 Component Pericentriolar material IDA 15107855
GO:0000281 Process Mitotic cytokinesis IMP 15107855
GO:0001103 Function RNA polymerase II repressing transcription factor binding IPI 22302990
GO:0001843 Process Neural tube closure ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600374 969 ENSG00000140463
Protein
UniProt ID Q96RK4
Protein name BBSome complex member BBS4 (Bardet-Biedl syndrome 4 protein)
Protein function The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This cilio
PDB 6XT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13414 TPR_11 108 146 Repeat
PF13414 TPR_11 175 216 Repeat
PF13181 TPR_8 270 303 Tetratricopeptide repeat Repeat
PF13181 TPR_8 338 369 Tetratricopeptide repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. The highest level of expression is found in the kidney.
Sequence
MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQ
ETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA
IEVYNEAAKLNQKDWEISHNLGVCYI
YLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLL
EGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLG
IYQKAFEHLGNALTYDPTNYKAIL
AAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLA
PFD
WKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRA
YAEAVHLDK
CNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEM
AQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRT
LPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK
Sequence length 519
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    BBSome-mediated cargo-targeting to cilium
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Bardet-biedl syndrome Bardet-Biedl Syndrome, Bardet-Biedl syndrome 1 (disorder), Bardet-Biedl syndrome 4 (disorder), Bardet-Biedl syndrome rs397704728, rs397515335, rs397515337, rs267607031, rs121918327, rs587777801, rs587777802, rs121918328, rs587777803, rs549625604, rs137852837, rs137852833, rs137852835, rs267606719, rs199874059
View all (560 more)
11381270, 30718709, 19402160, 30614526, 24849935, 27208204, 26518167, 12677556, 15666242, 12872256, 12016587, 15770229, 20498079
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Hypertension Hypertensive disease rs13306026
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Anus Neoplasms Associate 35318824
Bardet Biedl Syndrome Associate 10577922, 12016587, 12567324, 12677556, 15666242, 33964006, 35318824, 37031301, 37293956, 9227203
Bardet Biedl syndrome 4 Associate 35318824
Le Marec Bracq Picaud syndrome Associate 35318824
Liver Cirrhosis Associate 15666242
Malformations of Cortical Development Group II Stimulate 18762586
Mental Disorders Associate 18762586
Osteosarcoma Associate 40389469
Polydactyly Associate 15666242
Psychotic Disorders Associate 18762586