Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5819
Gene name	Nectin cell adhesion molecule 2
Gene symbol	NECTIN2
Synonyms (NCBI Gene)	CD112HVEBPRR2PVRL2PVRR2
Chromosome	19
Chromosome location	19q13.32
Summary	This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439851	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439851	hsa-miR-218-5p	HITS-CLIP	23212916

Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001675	Process	Acrosome assembly	IBA
GO:0001675	Process	Acrosome assembly	IEA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IBA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IEA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	12913096
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	IBA
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	IMP	16831868
GO:0005515	Function	Protein binding	IPI	16189514, 19011627, 21982860, 22902367, 23750010, 23758976, 25416956, 26755705, 27978489, 28515320, 32296183, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	28515320
GO:0005886	Component	Plasma membrane	IDA	16304049
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9657005
GO:0005911	Component	Cell-cell junction	IDA	9845526
GO:0005911	Component	Cell-cell junction	IEA
GO:0005915	Component	Zonula adherens	IEA
GO:0005915	Component	Zonula adherens	ISS	10225955
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IDA	9845526
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	ISS
GO:0007289	Process	Spermatid nucleus differentiation	IEA
GO:0009566	Process	Fertilization	IEA
GO:0009986	Component	Cell surface	IDA	16831868
GO:0015026	Function	Coreceptor activity	TAS	9657005
GO:0016020	Component	Membrane	IDA	12913096
GO:0016020	Component	Membrane	IEA
GO:0019064	Process	Fusion of virus membrane with host plasma membrane	IDA	12915581
GO:0030382	Process	Sperm mitochondrion organization	IEA
GO:0032989	Process	Cellular anatomical entity morphogenesis	IEA
GO:0033005	Process	Positive regulation of mast cell activation	IBA
GO:0033005	Process	Positive regulation of mast cell activation	IMP	16831868
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	8673704, 16582911, 36248894
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	15607800
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IEA
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IMP	12913096
GO:0042802	Function	Identical protein binding	IPI	21982860, 22902367, 22927415, 23758976, 28515320
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	9845526
GO:0043296	Component	Apical junction complex	IBA
GO:0043296	Component	Apical junction complex	IEA
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0044406	Process	Adhesion of symbiont to host	IDA	12915581
GO:0044782	Process	Cilium organization	IEA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388, 25870599
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	28515320
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IMP	16304049
GO:0046596	Process	Regulation of viral entry into host cell	IDA	11602758
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046814	Process	Coreceptor-mediated virion attachment to host cell	IBA
GO:0046814	Process	Coreceptor-mediated virion attachment to host cell	IDA	12915581
GO:0048018	Function	Receptor ligand activity	IDA	15607800, 28515320
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IPI	9845526, 12913096
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IBA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IDA	26755705
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051654	Process	Establishment of mitochondrion localization	IEA
GO:0060370	Process	Susceptibility to T cell mediated cytotoxicity	IDA	15039383
GO:0060370	Process	Susceptibility to T cell mediated cytotoxicity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
600798	9707	ENSG00000130202

Q92692

Protein name

Nectin-2 (Herpes virus entry mediator B) (Herpesvirus entry mediator B) (HveB) (Nectin cell adhesion molecule 2) (Poliovirus receptor-related protein 2) (CD antigen CD112)

Protein function

Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5,

PDB

3R0N , 4DFH , 4DFI , 4HZA , 5V52 , 8X6B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	37 → 159	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	159 → 249	CD80-like C2-set immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV

Sequence length

538

Interactions

View interactions

	KEGG		Reactome
	Virion - Herpesvirus Cell adhesion molecules Adherens junction Herpes simplex virus 1 infection		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Adherens junctions interactions Nectin/Necl trans heterodimerization

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cerebral palsy	Uncertain significance	rs1365743374	RCV001796579
Clear cell carcinoma of kidney	Benign	rs1966960	RCV005907609
NECTIN2-related disorder	Uncertain significance; Likely benign; Benign	rs1276887019, rs764175486, rs149820842, rs745722598, rs558397688, rs201817533, rs375813744, rs182813625, rs539311376, rs916044396, rs41290104, rs777165380, rs113179384, rs148321526, rs753238889 View all (12 more)	RCV003414274 RCV003938967 RCV003909480 RCV003929654 RCV003974735 RCV003904140 RCV003906768 RCV003933950 RCV003937368 RCV003939561 RCV003944508 RCV003936983 RCV003937239 RCV003922157 RCV003922251 RCV003926832 RCV003932251 RCV003927402 RCV003934331 RCV003949181 RCV003937397 RCV003971620 RCV003961976 RCV003969462 RCV003978910 RCV003915819 RCV003920608
Nonpapillary renal cell carcinoma	Likely benign	rs745722598	RCV005871389
Sarcoma	Benign	rs1966960	RCV005907610
Thyroid cancer, nonmedullary, 1	Benign	rs1966960	RCV005907611
Uterine corpus endometrial carcinoma	Benign	rs1966960	RCV005907612

Show/Hide Text Mining Associations (51)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	23330003
Adenocarcinoma of Lung	Associate	34102454
Alzheimer Disease	Associate	19442637, 22159054, 26543236, 27328823, 28650998, 29107063, 29739406, 31346172, 31755389, 32160291, 32709662, 34681041, 34752346, 36982982, 37108578, 37807778, 39177846, 39201500 View all (3 more)
Ascites	Associate	30843637
Breast Neoplasms	Associate	24386110
Calcinosis Cutis	Stimulate	24386110
Carcinogenesis	Associate	36916296
Carcinoma Hepatocellular	Associate	19404979, 22997493, 26936487
Carcinoma Pancreatic Ductal	Associate	26294807
Carcinoma Squamous Cell	Associate	23330003
Cerebral Hemorrhage	Associate	39298701
Cleft Lip	Associate	28230599
Cognition Disorders	Associate	31201950
Colonic Neoplasms	Stimulate	22189020
Coronary Artery Disease	Associate	39201500
Dementia	Associate	29739406
Diabetes Mellitus Type 2	Inhibit	34134627
Diabetes Mellitus Type 2	Associate	37108578
Dyslipidemias	Associate	29670124, 37108578
Farber Lipogranulomatosis	Associate	23330003
Frontotemporal Dementia	Associate	27899424
Gallbladder Neoplasms	Associate	23330003
Heart Defects Congenital	Associate	28230599
Hereditary Breast and Ovarian Cancer Syndrome	Associate	28515320
Hyperlipoproteinemia Type II	Associate	32727492
Hypersensitivity Immediate	Associate	38631604
Inflammation	Associate	34134627
Influenza Human	Associate	37807778
Leukemia	Associate	28807569
Leukemia Lymphocytic Chronic B Cell	Associate	37378949
Leukemia Myeloid Acute	Associate	29449224, 30639819, 33147937
Lung Neoplasms	Associate	35985690
Lymphatic Metastasis	Stimulate	23330003, 30843637
Lymphoma	Associate	30659053
Lymphoma Mantle Cell	Associate	30659053
Metabolic Syndrome	Associate	38201907
Myocardial Infarction	Associate	32727492
Neoplasm Metastasis	Associate	23330003, 29321541, 30843637, 36812781
Neoplasms	Stimulate	23330003, 30888046
Neoplasms	Associate	29217528, 30843637, 30908480, 32160291, 35967339, 35985690, 36812781, 37958883, 39369842
Neuroblastoma	Stimulate	36916296
Osteoporosis	Associate	32160291
Ovarian Neoplasms	Associate	30843637
Pancreatic Neoplasms	Stimulate	33062039
Pneumonia	Associate	37807778
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	15536144
Sarcoma	Associate	32082316
Severe Acute Respiratory Syndrome	Associate	28689229
Stomach Neoplasms	Associate	38631604
Urinary Bladder Neoplasms	Associate	29321541
Zlotogora Ogur syndrome	Associate	16740910

NECTIN2 (nectin cell adhesion molecule 2)