Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5817
Gene name Gene Name - the full gene name approved by the HGNC.
PVR cell adhesion molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PVR
Synonyms (NCBI Gene) Gene synonyms aliases
CD155, HVED, NECL5, Necl-5, PVS, TAGE4
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031973 hsa-miR-16-5p Proteomics 18668040
MIRT032490 hsa-let-7b-5p Proteomics 18668040
MIRT040310 hsa-miR-615-3p CLASH 23622248
MIRT690855 hsa-miR-339-5p HITS-CLIP 23313552
MIRT690854 hsa-miR-4421 HITS-CLIP 23313552
Transcription factors
Transcription factor Regulation Reference
ATM Activation 21406724
ATM Repression 21406724
TFAP2A Unknown 9880562
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IBA
GO:0001618 Function Virus receptor activity IEA
GO:0002860 Process Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target IEA
GO:0002860 Process Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target IMP 12913096
GO:0005515 Function Protein binding IPI 19011627, 21982860, 25416956, 28515320, 30591568, 31515488, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
173850 9705 ENSG00000073008
Protein
UniProt ID P15151
Protein name Poliovirus receptor (Nectin-like protein 5) (NECL-5) (CD antigen CD155)
Protein function Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse be
PDB 1DGI , 1NN8 , 3EPC , 3EPD , 3EPF , 3J8F , 3J9F , 3UDW , 3URO , 4FQP , 6ARQ , 6ISC , 6O3O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 32 142 Immunoglobulin V-set domain Domain
PF08205 C2-set_2 147 232 CD80-like C2-set immunoglobulin domain Domain
Sequence
MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTH
VSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGN
YTCLFVTFPQGSRSVDIWLRVL
AKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWH
SDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQ
LLTVNLTV
YYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVLGILVFLILLG
IGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR
Sequence length 417
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Nectin/Necl trans heterodimerization
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease, Alzheimer's disease or gastroesophageal reflux disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 30880756
Adenocarcinoma Associate 33185939, 38065981
Adenocarcinoma Bronchiolo Alveolar Associate 20331633
Adenocarcinoma of Lung Associate 20331633, 33576304, 34102454, 35262683, 35633885, 35710585, 37565582, 38065981, 39596207
Adenocarcinoma of Lung Stimulate 31954274
Alzheimer Disease Associate 28650998
Astrocytoma Associate 29878245
Autoimmune Diseases Associate 23980210
Brain Neoplasms Associate 29878245
Breast Neoplasms Associate 31035013, 31372841, 31830330, 32411795, 34608548, 37643511