Gene Gene information from NCBI Gene database.
Entrez ID 5817
Gene name PVR cell adhesion molecule
Gene symbol PVR
Synonyms (NCBI Gene)
CD155HVEDNECL5Necl-5PVSTAGE4
Chromosome 19
Chromosome location 19q13.31
Summary The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the
miRNA miRNA information provided by mirtarbase database.
476
miRTarBase ID miRNA Experiments Reference
MIRT031973 hsa-miR-16-5p Proteomics 18668040
MIRT032490 hsa-let-7b-5p Proteomics 18668040
MIRT040310 hsa-miR-615-3p CLASH 23622248
MIRT690855 hsa-miR-339-5p HITS-CLIP 23313552
MIRT690854 hsa-miR-4421 HITS-CLIP 23313552
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
ATM Activation 21406724
ATM Repression 21406724
TFAP2A Unknown 9880562
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IBA
GO:0001618 Function Virus receptor activity IEA
GO:0002860 Process Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target IEA
GO:0002860 Process Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target IMP 12913096
GO:0005515 Function Protein binding IPI 19011627, 21982860, 25416956, 28515320, 30591568, 31515488, 32296183, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
173850 9705 ENSG00000073008
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P15151
Protein name Poliovirus receptor (Nectin-like protein 5) (NECL-5) (CD antigen CD155)
Protein function Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse be
PDB 1DGI , 1NN8 , 3EPC , 3EPD , 3EPF , 3J8F , 3J9F , 3UDW , 3URO , 4FQP , 6ARQ , 6ISC , 6O3O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 32 142 Immunoglobulin V-set domain Domain
PF08205 C2-set_2 147 232 CD80-like C2-set immunoglobulin domain Domain
Sequence
MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTH
VSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGN
YTCLFVTFPQGSRSVDIWLRVL
AKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWH
SDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQ
LLTVNLTV
YYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVLGILVFLILLG
IGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR
Sequence length 417
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell adhesion molecules   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Nectin/Necl trans heterodimerization
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
18
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs11540085 RCV005938898
Malignant tumor of esophagus Benign rs11540085 RCV005938897
Malignant tumor of urinary bladder Benign rs11540085 RCV005938896
Melanoma Benign rs11540085 RCV005938901
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 30880756
Adenocarcinoma Associate 33185939, 38065981
Adenocarcinoma Bronchiolo Alveolar Associate 20331633
Adenocarcinoma of Lung Associate 20331633, 33576304, 34102454, 35262683, 35633885, 35710585, 37565582, 38065981, 39596207
Adenocarcinoma of Lung Stimulate 31954274
Alzheimer Disease Associate 28650998
Astrocytoma Associate 29878245
Autoimmune Diseases Associate 23980210
Brain Neoplasms Associate 29878245
Breast Neoplasms Associate 31035013, 31372841, 31830330, 32411795, 34608548, 37643511