Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5806
Gene name	Pentraxin 3
Gene symbol	PTX3
Synonyms (NCBI Gene)	TNFAIP5TSG-14
Chromosome	3
Chromosome location	3q25.32
Summary	This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononu

148

Show/Hide all (148)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005954	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT054880	hsa-miR-224-5p	Luciferase reporter assayqRT-PCRWestern blot	24470395
MIRT736826	hsa-miR-377-3p	RNA-seqqRT-PCR	33477862
MIRT1276844	hsa-miR-101	CLIP-seq
MIRT1276845	hsa-miR-144	CLIP-seq
MIRT1276846	hsa-miR-3163	CLIP-seq
MIRT1276847	hsa-miR-340	CLIP-seq
MIRT1276848	hsa-miR-4699-3p	CLIP-seq
MIRT1276849	hsa-miR-582-5p	CLIP-seq
MIRT1276850	hsa-miR-936	CLIP-seq
MIRT1552748	hsa-miR-129-5p	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT1552750	hsa-miR-1910	CLIP-seq
MIRT1552751	hsa-miR-2054	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT1552755	hsa-miR-3065-5p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552758	hsa-miR-337-3p	CLIP-seq
MIRT1552759	hsa-miR-3613-3p	CLIP-seq
MIRT1552760	hsa-miR-3622b-5p	CLIP-seq
MIRT1552761	hsa-miR-371-5p	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT1552763	hsa-miR-3942-3p	CLIP-seq
MIRT1552764	hsa-miR-421	CLIP-seq
MIRT1552765	hsa-miR-4282	CLIP-seq
MIRT1552766	hsa-miR-4326	CLIP-seq
MIRT1552767	hsa-miR-4495	CLIP-seq
MIRT1552768	hsa-miR-4646-3p	CLIP-seq
MIRT1552769	hsa-miR-4682	CLIP-seq
MIRT1552770	hsa-miR-4693-3p	CLIP-seq
MIRT1552771	hsa-miR-4720-5p	CLIP-seq
MIRT1552772	hsa-miR-4760-3p	CLIP-seq
MIRT1552773	hsa-miR-4762-5p	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT1552775	hsa-miR-4789-3p	CLIP-seq
MIRT1552776	hsa-miR-4799-3p	CLIP-seq
MIRT1552777	hsa-miR-513c	CLIP-seq
MIRT1552778	hsa-miR-514b-5p	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552780	hsa-miR-548ag	CLIP-seq
MIRT1552781	hsa-miR-548ai	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT1552783	hsa-miR-548s	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552785	hsa-miR-642a	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq
MIRT1552788	hsa-miR-942	CLIP-seq
MIRT1552789	hsa-miR-944	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT1552758	hsa-miR-337-3p	CLIP-seq
MIRT1556895	hsa-miR-4255	CLIP-seq
MIRT1552766	hsa-miR-4326	CLIP-seq
MIRT1556896	hsa-miR-4474-5p	CLIP-seq
MIRT1556897	hsa-miR-450b-5p	CLIP-seq
MIRT1556898	hsa-miR-4753-3p	CLIP-seq
MIRT1556899	hsa-miR-491-3p	CLIP-seq
MIRT1556900	hsa-miR-501-3p	CLIP-seq
MIRT1556901	hsa-miR-502-3p	CLIP-seq
MIRT1556902	hsa-miR-507	CLIP-seq
MIRT1552777	hsa-miR-513c	CLIP-seq
MIRT1552778	hsa-miR-514b-5p	CLIP-seq
MIRT1556903	hsa-miR-557	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1276844	hsa-miR-101	CLIP-seq
MIRT1276845	hsa-miR-144	CLIP-seq
MIRT1276846	hsa-miR-3163	CLIP-seq
MIRT1276848	hsa-miR-4699-3p	CLIP-seq
MIRT2081486	hsa-miR-4732-5p	CLIP-seq
MIRT1276849	hsa-miR-582-5p	CLIP-seq
MIRT1276850	hsa-miR-936	CLIP-seq
MIRT1552763	hsa-miR-3942-3p	CLIP-seq
MIRT1552769	hsa-miR-4682	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT1552750	hsa-miR-1910	CLIP-seq
MIRT1552751	hsa-miR-2054	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT1552755	hsa-miR-3065-5p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT2432344	hsa-miR-3200-5p	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552760	hsa-miR-3622b-5p	CLIP-seq
MIRT2432345	hsa-miR-3660	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT1552764	hsa-miR-421	CLIP-seq
MIRT2432346	hsa-miR-4310	CLIP-seq
MIRT2432347	hsa-miR-4526	CLIP-seq
MIRT1552768	hsa-miR-4646-3p	CLIP-seq
MIRT1552770	hsa-miR-4693-3p	CLIP-seq
MIRT2081486	hsa-miR-4732-5p	CLIP-seq
MIRT1556898	hsa-miR-4753-3p	CLIP-seq
MIRT1552773	hsa-miR-4762-5p	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT2432348	hsa-miR-520d-5p	CLIP-seq
MIRT2432349	hsa-miR-524-5p	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552780	hsa-miR-548ag	CLIP-seq
MIRT1552781	hsa-miR-548ai	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT2432350	hsa-miR-595	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552785	hsa-miR-642a	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq
MIRT2432351	hsa-miR-9	CLIP-seq
MIRT1552789	hsa-miR-944	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT2604993	hsa-miR-205	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT2604994	hsa-miR-3124-3p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT2432346	hsa-miR-4310	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT2604995	hsa-miR-511	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT2604993	hsa-miR-205	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT2604994	hsa-miR-3124-3p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT2432346	hsa-miR-4310	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT2604995	hsa-miR-511	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001550	Process	Ovarian cumulus expansion	IEA
GO:0001849	Function	Complement component C1q complex binding	IBA
GO:0001849	Function	Complement component C1q complex binding	IDA	23544079
GO:0001872	Function	(1->3)-beta-D-glucan binding	IEA
GO:0001878	Process	Response to yeast	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	19050261, 19632990, 20363749, 21490156, 22267482, 22786770, 28533443, 29374201, 35102342
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	1429570
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	23544079
GO:0006954	Process	Inflammatory response	TAS	1429570
GO:0006955	Process	Immune response	IEA
GO:0008228	Process	Opsonization	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	20363749
GO:0044793	Process	Host-mediated suppression of viral proces	IBA
GO:0044871	Process	Negative regulation by host of viral glycoprotein metabolic process	IDA	23544079
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	23544079
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	23544079
GO:0046790	Function	Virion binding	IDA	23544079
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0051707	Process	Response to other organism	IEA
GO:1903019	Process	Negative regulation of glycoprotein metabolic process	IDA	23544079
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
602492	9692	ENSG00000163661

P26022

Protein name

Pentraxin-related protein PTX3 (Pentaxin-related protein PTX3) (Tumor necrosis factor alpha-induced protein 5) (TNF alpha-induced protein 5) (Tumor necrosis factor-inducible gene 14 protein) (TSG-14)

Protein function

Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.

PDB

7ZL1 , 8PVQ , 8S50

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00354	Pentaxin	181 → 379	Pentaxin family	Domain

Sequence

MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLF
IMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL
LQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCE
TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
SYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIR
GNIVGWGVTEIQPHGGAQYVS

Sequence length

381

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Gastric cancer	Benign	rs191352729	RCV005906392
Ovarian serous cystadenocarcinoma	Benign	rs191352729	RCV005906393
PTX3-related disorder	Uncertain significance; Benign	rs1349378403, rs1734203852, rs1734208616, rs759937518, rs141322370	RCV003406198 RCV003982763 RCV003983404 RCV003976474 RCV003955919

Show/Hide Text Mining Associations (174)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Chest Syndrome	Associate	23735470
Acute Coronary Syndrome	Stimulate	24709882
Acute Kidney Injury	Stimulate	26817892, 38110934
Acute Kidney Injury	Associate	33863396
Adenocarcinoma	Associate	33967610
Alzheimer Disease	Associate	21112127
Anemia	Associate	25401491
Anemia Sickle Cell	Associate	23735470
Anemia Sickle Cell	Stimulate	28436274
Aneurysm	Associate	33912155
Angioedemas Hereditary	Stimulate	26654922
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	26027989
Aortic Aneurysm Familial Abdominal 1	Associate	31703088
Aortic Dissection	Associate	39991758
Arterial Occlusive Diseases	Associate	23735470
Arthritis Rheumatoid	Associate	10606983, 34248970, 35360114
Asthma	Associate	22529962, 37957139
Ataxia Telangiectasia	Associate	25887408
Atherosclerosis	Associate	23573312, 24146263, 25550806, 26138903, 32028277, 33413676, 35874788
Atrial Fibrillation	Associate	32028277
Atypical Hemolytic Uremic Syndrome	Associate	22786770
Bacterial Infections	Stimulate	28458531
Bacterial Infections	Associate	28458531
Blister	Associate	35874788
Bone Diseases	Associate	27458153, 34248970
Brain Ischemia	Associate	37270727
Brain Neoplasms	Associate	26563370
Breast Neoplasms	Associate	26563370, 28223411, 32427938, 36555812
Cachexia	Associate	37712645
Carcinoma Non Small Cell Lung	Associate	34394080
Carcinoma Renal Cell	Stimulate	32345771, 37563650
Carcinoma Renal Cell	Associate	36902242
Cardiovascular Diseases	Stimulate	19164811
Cardiovascular Diseases	Associate	21173097, 23658833, 26138903, 26842615, 33413676
Central Nervous System Diseases	Associate	27344170
Chlamydia Infections	Associate	31383744
Chronic Disease	Associate	19164811
Cognition Disorders	Inhibit	31808814
Cognitive Dysfunction	Stimulate	31808814
Colorectal Neoplasms	Associate	27568661, 37511338
Communicable Diseases	Associate	22834944, 38053036
Communication Disorders	Stimulate	32894554
Communication Disorders	Associate	33906523
Complement Factor H Deficiency	Associate	26176960
Corneal Diseases	Associate	33373496
Corneal Endothelial Cell Loss	Associate	25550806
Coronary Aneurysm	Associate	33912155
Coronary Artery Disease	Associate	33912155
COVID 19	Associate	33208929, 33399033, 34314051, 36315310, 37657050
Crohn Disease	Associate	39519095
Cystic Fibrosis	Associate	20927127, 22834944
Cystic Fibrosis	Inhibit	23516586
Death	Associate	19164811, 28228104, 34285273
Dermatomyositis	Inhibit	37280166
Diabetes Gestational	Inhibit	26842615
Diabetes Mellitus	Associate	28739185, 34128842
Diabetes Mellitus Type 2	Associate	28119515, 35883173
Diabetic Nephropathies	Associate	28119515
Diabetic Retinopathy	Associate	35577071
Drug Hypersensitivity	Associate	34507654
Dyslipidemias	Associate	26842615
Endometrial Neoplasms	Associate	34195683
Endometriosis	Associate	39497588
Epilepsies Myoclonic	Associate	27344170
Esophageal Neoplasms	Associate	27893424
Esophageal Squamous Cell Carcinoma	Inhibit	22072855
Essential Hypertension	Associate	34128842
Fatty Liver	Associate	37657050
Fibrosis	Associate	38111581, 39519095
Giant Cell Arteritis	Associate	21989653
Giant Cell Arteritis	Stimulate	31573481
Glioblastoma	Associate	24503185, 35855654
Glioblastoma	Stimulate	38359612
Glioma	Associate	30942197, 36153549, 36647288, 37063077, 37439825, 40656950
Glomerulonephritis	Associate	26027989
Graves Ophthalmopathy	Stimulate	29675428
Head and Neck Neoplasms	Associate	34344926
Hematuria	Stimulate	26817892
Heredodegenerative Disorders Nervous System	Associate	27344170
Hypomagnesemia primary	Associate	33208929
Hypothyroidism Congenital Nongoitrous 2	Associate	22633261
Hypoxia	Stimulate	20151982
Impotence Vasculogenic	Associate	36555812
Infarction	Stimulate	33122738
Inferior Wall Myocardial Infarction	Associate	27775787
Infertility	Associate	39497588
Inflammation	Associate	12832416, 1429570, 15673302, 19164811, 21112127, 21489226, 21989653, 22529962, 22632920, 23285251, 23401658, 23658833, 23735470, 23954061, 24415446 View all (30 more)
Inflammation	Stimulate	22786770
Insulin Resistance	Associate	35059041
Ischemia	Associate	23735470
Kidney Diseases	Associate	31780874
Kidney Failure Chronic	Associate	34285273
Larva Migrans	Associate	38111581
Leprosy	Stimulate	38053036
Leukemia	Associate	29202702
Leukemia Lymphocytic Chronic B Cell	Associate	35595309
Lung Neoplasms	Associate	26348770, 30483742
Lung Neoplasms	Stimulate	32587638
Lupus Erythematosus Systemic	Stimulate	25401491
Lupus Erythematosus Systemic	Associate	28257596, 31137925
Lupus Nephritis	Associate	26817892
Lymphedema	Stimulate	38111581
Lymphoma Large B Cell Diffuse	Associate	34706126
Macrophage Activation Syndrome	Associate	34314051
Macular Degeneration	Associate	26176960, 29374201, 31795454
Meningioma	Associate	28327132
Metabolic Syndrome	Associate	21900125
Migraine Disorders	Stimulate	35895308
MINOCA	Associate	33121529
Mucocutaneous Lymph Node Syndrome	Associate	33912155
Mycoses	Associate	30275011
Myocardial Infarction	Associate	23285251, 31772617
Myocardial Infarction	Stimulate	24737925
Myositis	Associate	37280166
Necrosis	Associate	22511625
Neoplasm Metastasis	Associate	27458153, 30483742, 32345771, 35090088, 39187920
Neoplasms	Associate	21489226, 23573312, 27893424, 28223411, 28228104, 30483742, 32345771, 33110136, 35090088, 36647288, 39187920, 40656950
Neoplasms	Inhibit	22072855
Neoplasms	Stimulate	30942197
Nephritis Interstitial	Associate	26817892
Nephrotic Syndrome	Stimulate	26817892
Neuroblastoma	Associate	38063204
Non alcoholic Fatty Liver Disease	Stimulate	35059041
Obesity	Associate	21900125, 34507654, 35317787
Optic Neuropathy Ischemic	Associate	21989653
Osteoarthritis	Stimulate	33931080
Osteoarthritis	Associate	34208590
Osteolysis	Associate	27458153
Osteoporosis	Associate	29022895
Osteoporosis	Stimulate	33931080
Osteoporotic Fractures	Inhibit	29022895
Ovarian Diseases	Associate	22633261
Pancreatic Neoplasms	Associate	23828517, 25409614
Periodontitis	Associate	35360114
Peripheral Arterial Disease	Associate	22123215
Plaque Atherosclerotic	Stimulate	23954061
Pneumonia	Stimulate	32587638
Pneumonia	Associate	40684182
Polycystic Ovary Syndrome	Associate	24279306, 37930517, 38167474
Polycythemia Vera	Associate	21173097, 28228104
Pre Eclampsia	Associate	24724970
Primary Graft Dysfunction	Associate	22822025, 27421969
Prostatic Neoplasms	Associate	33110136, 39187920
Pulmonary Disease Chronic Obstructive	Inhibit	21920889
Pulmonary Disease Chronic Obstructive	Associate	28458531
Renal Insufficiency Chronic	Stimulate	23658833, 34285273
Respiratory Tract Infections	Associate	33906523
Retinitis	Associate	29374201
Sepsis	Stimulate	28458531
Severe Acute Respiratory Syndrome	Associate	33906523
Sleep Apnea Obstructive	Associate	25237185
Small Cell Lung Carcinoma	Stimulate	32587638
Spondylitis Ankylosing	Associate	27538101
Squamous Cell Carcinoma of Head and Neck	Associate	33526991, 34917682
Status Asthmaticus	Associate	22529962
Stiff Skin Syndrome	Associate	26842615
Stomach Neoplasms	Associate	27458153, 35854776
Takayasu Arteritis	Stimulate	31573481
Teratoma	Associate	26965297
Thrombocythemia Essential	Associate	21173097, 28228104, 31801935
Thrombosis	Inhibit	21173097
Thyroid Neoplasms	Associate	37705974
Triple Negative Breast Neoplasms	Associate	35090088
Tuberculosis	Inhibit	17611589
Tuberculosis	Stimulate	40684182
Tuberculosis Pulmonary	Associate	17611589, 40684182
Uremia	Associate	23658833
Vascular Diseases	Stimulate	23658833
Vascular Diseases	Associate	25550806, 26138903, 27915246, 33413676
Vascular System Injuries	Associate	25401491, 27915246
Vasculitis	Associate	25401491, 31573481
Vasculitis	Stimulate	32734361
Ventricular Dysfunction Left	Associate	21448138, 39375631
Weight Loss	Stimulate	24415446

PTX3 (pentraxin 3)