Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5788
Gene name	Protein tyrosine phosphatase receptor type C
Gene symbol	PTPRC
Synonyms (NCBI Gene)	B220CD45CD45RGP180IMD105L-CALCALY5T200
Chromosome	1
Chromosome location	1q31.3-q32.1
Summary	The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transforma

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs114970039	T>C	Likely-pathogenic, uncertain-significance	Genic downstream transcript variant, missense variant, coding sequence variant
rs116464756	A>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Genic downstream transcript variant, missense variant, coding sequence variant
rs137869655	G>A,T	Likely-pathogenic	Genic downstream transcript variant, intron variant, splice donor variant
rs142941257	G>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, genic downstream transcript variant, missense variant
rs150672767	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, genic downstream transcript variant, coding sequence variant
rs201715157	T>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, missense variant, coding sequence variant, genic downstream transcript variant
rs398122383	A>G,T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, stop gained
rs1553243550	G>A	Likely-pathogenic	Genic downstream transcript variant, splice donor variant
rs1571865049	G>A	Pathogenic	Splice donor variant, genic downstream transcript variant
rs1571880832	C>G	Pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs1571880941	AG>T	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant

Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT722509	hsa-miR-4464	HITS-CLIP	19536157
MIRT722508	hsa-miR-4748	HITS-CLIP	19536157
MIRT722507	hsa-miR-4653-3p	HITS-CLIP	19536157
MIRT722506	hsa-miR-3198	HITS-CLIP	19536157
MIRT722505	hsa-miR-4309	HITS-CLIP	19536157
MIRT722504	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT722503	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT722509	hsa-miR-4464	HITS-CLIP	19536157
MIRT722508	hsa-miR-4748	HITS-CLIP	19536157
MIRT722507	hsa-miR-4653-3p	HITS-CLIP	19536157
MIRT722506	hsa-miR-3198	HITS-CLIP	19536157
MIRT722505	hsa-miR-4309	HITS-CLIP	19536157
MIRT722504	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT722503	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT1275993	hsa-miR-875-3p	CLIP-seq
MIRT2393256	hsa-miR-3161	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ESR2	Unknown	11517296

141

Show/Hide all (141)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	12574355
GO:0000165	Process	MAPK cascade	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001779	Process	Natural killer cell differentiation	ISS
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IEA
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	ISS
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	IEA
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	ISS
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IMP	21911094
GO:0002639	Process	Positive regulation of immunoglobulin production	IMP	1793833
GO:0002711	Process	Positive regulation of T cell mediated immunity	IEA
GO:0002923	Process	Regulation of humoral immune response mediated by circulating immunoglobulin	IEA
GO:0002925	Process	Positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	2853967
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	ISS
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS	15095367
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	IGI	12574355
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	TAS	2845400, 15557316
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	1970422, 7507203, 8576115, 10369126, 11909961, 12370829, 15946252, 19167335, 31980649
GO:0005886	Component	Plasma membrane	IDA	12354383
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	2956090
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	ISS
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	9197241
GO:0006469	Process	Negative regulation of protein kinase activity	ISS
GO:0006470	Process	Protein dephosphorylation	ISS
GO:0006933	Process	Negative regulation of cell adhesion involved in substrate-bound cell migration	IMP	21911094
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	2845400
GO:0008201	Function	Heparin binding	IEA
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	NAS	15661907
GO:0009986	Component	Cell surface	IDA	12100025, 12354383, 24337748
GO:0009986	Component	Cell surface	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	15095367
GO:0016311	Process	Dephosphorylation	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	14625311
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030217	Process	T cell differentiation	IEA
GO:0030217	Process	T cell differentiation	ISS
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IDA	12100025
GO:0030506	Function	Ankyrin binding	IPI	12354383
GO:0030507	Function	Spectrin binding	IDA	12354383
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	1793833
GO:0032059	Component	Bleb	IDA	12354383
GO:0032677	Process	Regulation of interleukin-8 production	IDA	12100025
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	ISS
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042100	Process	B cell proliferation	IEA
GO:0042100	Process	B cell proliferation	ISS
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	ISS
GO:0042110	Process	T cell activation	TAS	12354383
GO:0042492	Process	Gamma-delta T cell differentiation	IEA
GO:0043395	Function	Heparan sulfate proteoglycan binding	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044770	Process	Cell cycle phase transition	IMP	1793833
GO:0044855	Process	Plasma membrane raft distribution	IEA
GO:0044855	Process	Plasma membrane raft distribution	ISS
GO:0045059	Process	Positive thymic T cell selection	IEA
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045202	Component	Synapse	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045588	Process	Positive regulation of gamma-delta T cell differentiation	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	NAS	15275963
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IGI	12574355
GO:0046633	Process	Alpha-beta T cell proliferation	IEA
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	IEA
GO:0048304	Process	Positive regulation of isotype switching to IgG isotypes	IEA
GO:0048539	Process	Bone marrow development	IMP	21911094
GO:0048864	Process	Stem cell development	IMP	21911094
GO:0050764	Process	Regulation of phagocytosis	IDA	12100025
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	ISS
GO:0050852	Process	T cell receptor signaling pathway	IDA	35271814
GO:0050852	Process	T cell receptor signaling pathway	IDA	10358156
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS	15557316
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	ISS
GO:0050856	Process	Regulation of T cell receptor signaling pathway	IEA
GO:0050856	Process	Regulation of T cell receptor signaling pathway	ISS
GO:0050857	Process	Positive regulation of antigen receptor-mediated signaling pathway	IEA
GO:0050857	Process	Positive regulation of antigen receptor-mediated signaling pathway	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	IEA
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	ISS	18249142
GO:0070062	Component	Extracellular exosome	HDA	12519789, 20458337
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0071944	Component	Cell periphery	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0098857	Component	Membrane microdomain	IEA
GO:0098857	Component	Membrane microdomain	ISS
GO:1902215	Process	Negative regulation of interleukin-4-mediated signaling pathway	IGI	12574355
GO:1903979	Process	Negative regulation of microglial cell activation	TAS	15095367
GO:1904044	Process	Response to aldosterone	IEA
GO:1904155	Process	DN2 thymocyte differentiation	TAS	15557316
GO:2000473	Process	Positive regulation of hematopoietic stem cell migration	IMP	21911094
GO:2000648	Process	Positive regulation of stem cell proliferation	IMP	21911094
GO:2001236	Process	Regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
151460	9666	ENSG00000081237

P08575

Protein name

Receptor-type tyrosine-protein phosphatase C (EC 3.1.3.48) (Leukocyte common antigen) (L-CA) (T200) (CD antigen CD45)

Protein function

Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor (PubMed:35767951). Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while t

PDB

1YGR , 1YGU , 5FMV , 5FN6 , 5FN7 , 8VSE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12453	PTP_N	7 → 32	Protein tyrosine phosphatase N terminal	Family
PF12567	CD45	237 → 295	Leukocyte receptor CD45	Family
PF00041	fn3	392 → 466	Fibronectin type III domain	Domain
PF00041	fn3	486 → 565	Fibronectin type III domain	Domain
PF00102	Y_phosphatase	677 → 911	Protein-tyrosine phosphatase	Domain
PF00102	Y_phosphatase	968 → 1227	Protein-tyrosine phosphatase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1: Detected in thymocytes. Isoform 2: Detected in thymocytes. Isoform 3: Detected in thymocytes. Isoform 4: Not detected in thymocytes. Isoform 5: Detected in thymocytes. Isoform 6: Not detected in thymocytes. Isoform 7: Detect

Sequence

MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPA
STFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSA
GTDTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAAL
PARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYL
YNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVP
PGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLE
PEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFH
NFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTT
KSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFR
VKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYK
IYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSI
PRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPR
KYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVV
VKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNA
FSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEA
QYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQ
HIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINA
SFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGK
QTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISM
IQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQV
VKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDAN
CVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS

Sequence length

1306

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules T cell receptor signaling pathway Fc gamma R-mediated phagocytosis Salmonella infection Primary immunodeficiency		Phosphorylation of CD3 and TCR zeta chains Other semaphorin interactions Neutrophil degranulation

1084

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency 104	Likely pathogenic; Pathogenic	rs2102475830, rs2102415377, rs2102393172, rs2102445016, rs2528046063, rs2527991012, rs2528049157, rs1553243550, rs2527787867, rs2527780456, rs2528046958, rs2527386785, rs745816899, rs1654941272, rs2528037788 View all (10 more)	RCV001379776 RCV001968938 RCV001963234 RCV001914067 RCV003514758 RCV003516231 RCV003514125 RCV003514785 RCV003515191 RCV003515790 RCV003515974 RCV003515924 RCV003627789 RCV003627831 RCV003627952 RCV003627942 RCV003628386 RCV003628401 RCV003628572 RCV003626290 RCV003626344 RCV003626448 RCV003627434 RCV000640060 RCV000787279 RCV003626641 RCV000820287 RCV001236197
Immunodeficiency 105	Pathogenic; Likely pathogenic	rs2102393172, rs754092059, rs1571865049, rs2527818757, rs1654941272, rs137869655, rs398122383	RCV002283573 RCV003133723 RCV002260598 RCV002260599 RCV005013089 RCV005013162 RCV002260603
Severe combined immunodeficiency disease	Likely pathogenic	rs1665977328	RCV002223074

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign	rs59271985, rs79141749, rs774932185	RCV005921990 RCV005900851 RCV005910578
Cervical cancer	Likely benign; Benign	rs768853912, rs774932185	RCV005928281 RCV005910580
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Likely benign	rs749945770	RCV005926033
Familial cancer of breast	Benign	rs774932185	RCV005910576
Gastric cancer	Uncertain significance; Benign	rs140422357, rs57296163, rs762123424	RCV005924279 RCV005870674 RCV005902019
Hepatitis C virus, susceptibility to	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	rs369311409, rs57296163, rs375051221, rs1666552982, rs114970039, rs79141749, rs41314039	RCV002504673 RCV002477899 RCV002478237 RCV002208766 RCV002485087 RCV002480285 RCV002481643 RCV002491299
Hepatocellular carcinoma	Benign	rs57296163	RCV005870672
Malignant lymphoma, large B-cell, diffuse	Benign	rs57296163	RCV005870673
Malignant tumor of esophagus	Benign; Likely benign	rs79141749, rs774932185	RCV005900852 RCV005910579
PTPRC POLYMORPHISM	Benign; Likely benign	rs17612648	RCV002260636
PTPRC-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance	rs145983642, rs747910304, rs372045826, rs375079291, rs551218477, rs747502666, rs115797104, rs142941257, rs79141749, rs142096878, rs150672767, rs146402228, rs140403368, rs201715157, rs116464756 View all (4 more)	RCV003938823 RCV003948458 RCV003948411 RCV003926286 RCV003906330 RCV003959554 RCV003959992 RCV004758011 RCV003932566 RCV003922740 RCV003925509 RCV004758033 RCV003962511 RCV003905649 RCV003915764 RCV003965348 RCV003975314 RCV003975651 RCV004758137
Sarcoma	Benign	rs774932185	RCV005910581
See cases	Uncertain significance	rs113148246	RCV002252298
Squamous cell carcinoma of the head and neck	Benign	rs774932185	RCV005910577
Thymoma	Benign	rs59271985	RCV005921991
Uterine corpus endometrial carcinoma	Uncertain significance; Benign; Likely benign	rs139041596, rs79141749, rs57296163	RCV005911185 RCV005900853 RCV005870675

Show/Hide Text Mining Associations (377)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Associate	22606231
Achondroplasia and Swiss type agammaglobulinemia	Associate	1373352, 21488866
Acne Vulgaris	Associate	31281837
Acquired Immunodeficiency Syndrome	Associate	15996199, 7612102
Acquired Immunodeficiency Syndrome	Inhibit	16721821
Acute Disease	Associate	1320953, 21323873, 9158095
Adenocarcinoma	Associate	21054833, 32487090, 32509861
Adenocarcinoma of Lung	Associate	30587197, 34863300, 34887322, 37061716, 37671160
Adrenal Gland Diseases	Associate	11473470
Alcoholism	Stimulate	32725203
Allergic Fungal Sinusitis	Associate	30720103, 38441343
Allergic Fungal Sinusitis	Stimulate	33251550
Alzheimer Disease	Associate	15538542, 33081847, 36035305, 40369481
Amyotrophic Lateral Sclerosis	Associate	1347673
Anemia Aplastic	Associate	8701944
Anemia Diamond Blackfan	Associate	25755292
Anemia Refractory	Associate	12239142
Aneuploidy	Associate	25277787
Anodontia	Associate	21400022
Aortic Aneurysm Abdominal	Associate	22797469, 25454106, 26287481
Aortic Aneurysm Abdominal	Stimulate	33858751
Arrhythmogenic Right Ventricular Dysplasia	Stimulate	31843279
Arthritis	Associate	8033417
Arthritis Juvenile	Associate	18576332
Arthritis Psoriatic	Associate	34681660
Arthritis Rheumatoid	Associate	12239142, 12393721, 12695561, 1347492, 14691302, 19886735, 19898481, 20309874, 21952740, 22355377, 22594821, 23280063, 25834819, 26314565, 28358698 View all (12 more)
Arthritis Rheumatoid	Inhibit	25126574, 9135557
Arthritis Rheumatoid	Stimulate	34394126
Ascites	Associate	28679689, 36933411, 38232734
Asthma	Inhibit	18250971
Asthma	Associate	32828590, 38129444, 39380119
Ataxia Telangiectasia	Associate	10606975, 18505566, 34248969
Atherosclerosis	Associate	34122426, 35304503, 35509837
Atrial Fibrillation	Associate	36653368
Autoimmune Diseases	Inhibit	14575152
Autoimmune Diseases	Associate	17100764, 21507955, 26616563, 28759630, 36280286
Autoimmune Diseases	Stimulate	24760111
Autoimmune Lymphoproliferative Syndrome	Associate	12492582, 29686686, 33170215
Autoimmune Lymphoproliferative Syndrome	Stimulate	9811346
Axial Spondyloarthritis	Associate	25688074
Behcet Syndrome	Associate	18685727, 9030859
Biliary Tract Diseases	Associate	40596471
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	35035862
Blast Injuries	Associate	22328535
Bone Marrow Diseases	Associate	9136941
Brain Diseases	Associate	17284118
Brain Neoplasms	Stimulate	40621453
Breast Neoplasms	Associate	30914433, 31795964, 32228503, 37388747, 38250718, 39874011, 8946143
Bronchiectasis	Stimulate	9828857
Bronchiolitis Obliterans Syndrome	Associate	24577531, 25460358
Budd Chiari Syndrome	Associate	29771426
Burkitt Lymphoma	Associate	29327714
Capillary Malformation Arteriovenous Malformation	Associate	31169231
Carcinoma Hepatocellular	Stimulate	17372588, 40410708
Carcinoma Hepatocellular	Associate	25780289, 26517519, 31227589, 31675496, 35637248
Carcinoma Medullary	Stimulate	20092246
Carcinoma Non Small Cell Lung	Associate	31176366, 34633989, 35874785
Carcinoma Ovarian Epithelial	Associate	19673890, 31319587, 37868997
Carcinoma Pancreatic Ductal	Associate	31381571, 35793870, 35836806
Carcinoma Pancreatic Ductal	Inhibit	37347110
Carcinoma Renal Cell	Associate	21934683, 29559845, 31950034, 33504936, 34149719, 36793506, 36854280
Carcinoma Squamous Cell	Associate	31169231
Cardiac Output Low	Associate	33795387
Carney Complex	Associate	37151356
Carotid Artery Diseases	Associate	36316672
Carrington syndrome	Associate	7489791
Cartilage hair hypoplasia	Associate	9584003
Celiac Disease	Associate	23340820
Chickenpox	Associate	8340752
Cholangiocarcinoma	Associate	29031565
Cholangiocarcinoma	Stimulate	40410708
Cholangitis	Stimulate	30034306
Cholangitis Sclerosing	Associate	11943728, 1385768
Chondrocalcinosis 2	Associate	35008858
Chromosome 12 12p trisomy	Associate	23733486
Chronic Kidney Diseases of Uncertain Etiology	Associate	8342596
Chronic Periodontitis	Associate	1834575
Cognition Disorders	Associate	33324408
Colitis	Associate	37160121
Colitis Ulcerative	Associate	15020649, 26345973, 32871953, 37638002
Colitis Ulcerative	Inhibit	17602351, 23039882, 31660620, 33295628
Colitis Ulcerative	Stimulate	9071939
Colonic Neoplasms	Associate	29580161
Colorectal Neoplasms	Associate	20480531, 20665489, 20846416, 21818290, 22276195, 28629469, 31142796, 33527196, 37327339, 8150352
Colorectal Neoplasms	Inhibit	33625532
Common Variable Immunodeficiency	Associate	10403927, 14616794, 16412063, 17223965, 27188997
Common Variable Immunodeficiency	Inhibit	12165093, 1395097, 1638763
Communicable Diseases	Associate	17100764
Congenital heart block	Associate	30518570
Conversion Disorder	Associate	33324408
Coronary Artery Disease	Associate	11882051, 30844764, 34320932
Coronary Disease	Associate	18578002
COVID 19	Associate	33205351, 35698744, 36217141, 36562254, 36585293, 36924127, 38069209
Crohn Disease	Associate	15020649, 22167015, 23039882, 7506695, 9071939
Crohn Disease	Stimulate	17602351
Crohn Disease	Inhibit	33295628
Cystic Fibrosis	Associate	14525626
Cytokine Release Syndrome	Associate	11062606
Cytomegalovirus Infections	Associate	11418475, 12393740, 12516570, 12730101, 15484193, 18173357, 36831183, 9068311
Cytomegalovirus Infections	Stimulate	36426948
Cytomegalovirus Infections	Inhibit	7664187
Death	Associate	29021228, 32150457, 37388747
Death	Stimulate	35287794
Dendritic Cell Sarcoma Follicular	Associate	19883432
Depressive Disorder	Associate	37238593, 38593939, 40170649
Dermatitis Atopic	Associate	11989619
Diabetes Gestational	Associate	26494027, 31783860
Diabetes Mellitus	Associate	25899460
Diabetes Mellitus Type 1	Associate	15358643, 1696864, 18803760, 23409157, 25421756, 25652388, 29229565, 30082321
Diabetes Mellitus Type 2	Associate	24429578, 30270447, 39217825
Diabetes Mellitus Type 2	Stimulate	30574794
Diabetes Mellitus Type 2	Inhibit	35370964
Diabetic Retinopathy	Associate	37773794
DiGeorge Syndrome	Associate	20491792
Disease	Associate	2149120, 25421756
Disease	Stimulate	9038663
Disease Progression	Associate	33819512
Diverticulitis	Associate	28619727
Drug Hypersensitivity	Stimulate	38203472
Drug Hypersensitivity	Inhibit	9241767
Drug Related Side Effects and Adverse Reactions	Associate	37651540
Duodenal Ulcer	Stimulate	12738386
Dyskeratosis Congenita	Associate	17468339
Elliptocytosis 1	Associate	2070088
Endometriosis	Stimulate	29226157
Endometriosis	Associate	30134794, 35303800
Enteritis	Associate	40560796
Epidermodysplasia Verruciformis	Associate	35202881
Epidermolysis Bullosa	Associate	28736230
Epiretinal Membrane	Associate	27168718
Epstein Barr Virus Infections	Associate	11067931, 8340752
Epstein Barr Virus Infections	Stimulate	9135557
Esophageal Achalasia	Associate	36450816
Esophageal Neoplasms	Associate	32255255
Esophageal Squamous Cell Carcinoma	Associate	37839637
Essential Hypertension	Associate	36891527
Fatigue Syndrome Chronic	Associate	26032326
Fibrosis	Associate	20462651, 35159124, 40596471
Focal Epithelial Hyperplasia of the Oral Mucosa	Associate	26125927
Giant Cell Tumors	Associate	26275199
Glioblastoma	Associate	18230189, 19288188, 35558067
Glioma	Associate	18398462, 28620836, 31649684, 34923867, 39349581
Glomerulonephritis IGA	Stimulate	20484297
Glomerulonephritis IGA	Associate	29137483
Glucagonoma	Associate	35812422
Graft vs Host Disease	Inhibit	16982336
Granuloma Giant Cell	Associate	26275199
Granulomatosis with Polyangiitis	Associate	12716450, 16837919, 22490506
Graves Disease	Associate	30956992, 7900942
Graves Ophthalmopathy	Stimulate	10781517
Graves Ophthalmopathy	Associate	23092922
Hashimoto Disease	Associate	28660994
Head and Neck Neoplasms	Associate	34471285
Heart Failure	Inhibit	21935395, 36761158
Heart Failure	Associate	25984539
Heart Valve Diseases	Associate	23417848
Hemangioblastoma	Associate	26468019
Hematologic Neoplasms	Associate	24952935, 27100180, 37651540
Hemoglobinuria Paroxysmal	Associate	23281097
Hemolysis	Associate	26285098
Hemophilia B	Stimulate	10354153
Hepatitis Autoimmune	Associate	17903220
Hepatitis C Chronic	Associate	17903220
Hepatitis Chronic	Associate	1385768
Hereditary leiomyomatosis and renal cell cancer	Associate	1352942, 1656757, 3970138
Heredodegenerative Disorders Nervous System	Associate	22633193
Histiocytic Sarcoma	Associate	1647137
Histiocytoma Malignant Fibrous	Associate	2426951
Histiocytosis Langerhans Cell	Associate	3280696
HIV Infections	Associate	10447730, 11032864, 11063505, 11449406, 11535497, 17005693, 17465678, 1830025, 18426338, 20424187, 21298072, 22457280, 22879601, 28375551, 31519862 View all (8 more)
HIV Infections	Stimulate	18495780, 18538835, 7586672
HIV Infections	Inhibit	18996749, 8906753
HIV Seropositivity	Stimulate	18163491
Hodgkin Disease	Associate	21859738, 2297052, 26084540, 2675617, 35989518
HTLV I Infections	Associate	11956207, 17483473, 17942534
Hyperplasia	Associate	30720103, 35586138
Hypersensitivity Immediate	Associate	27764137, 9241767
Hypertension	Associate	27367286
Idiopathic Pulmonary Fibrosis	Associate	16394278, 22037258, 32378592
IgA Vasculitis	Associate	27769184, 7503950
Immune Reconstitution Inflammatory Syndrome	Associate	30728405
Immune System Diseases	Associate	19898481, 9030859
Immunologic Deficiency Syndromes	Associate	11737063
Infections	Associate	11287558, 11737063, 17942534, 21711347, 22171268, 30181507, 36637125, 9697980
Infections	Stimulate	23822699
Infectious Mononucleosis	Associate	12130505, 1320953, 8329707, 8340752, 9158095
Infertility	Associate	36603467
Inflammation	Associate	10598756, 10942899, 11062606, 12716450, 15538542, 16388711, 17107594, 17483473, 19153557, 19199469, 19351711, 20150436, 21482872, 22182738, 22633193 View all (14 more)
Inflammatory Bowel Diseases	Associate	15020649, 17602351, 37160121, 9329971
Intervertebral Disc Degeneration	Associate	33764282
Intrahepatic Cholestasis of Pregnancy	Associate	35643225
Keloid	Associate	34553702
Kidney Diseases	Associate	23894540, 38174742
Laryngeal Diseases	Associate	36319566
Laryngeal Neoplasms	Associate	37116830
Leukemia	Associate	10539882, 11301185, 11342451, 1530879, 1531305, 18319522, 21046101, 2960856, 30614203, 32812702, 37818740, 37933409, 7513207, 7587745, 8611704
Leukemia Biphenotypic Acute	Inhibit	11754202
Leukemia Hairy Cell	Associate	11754202
Leukemia Large Granular Lymphocytic	Associate	12480700, 12492582, 15198732
Leukemia Lymphocytic Chronic B Cell	Associate	11754202, 23733486, 2531721, 2960856, 9885225
Leukemia Lymphoid	Associate	16412063
Leukemia Monocytic Acute	Associate	10539882
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	12829610, 1370638
Leukemia Myeloid Acute	Associate	10539882, 16569594, 18061946, 19490757, 21046101, 24300852, 30347598, 32865882, 33811445, 36977512, 37651540, 37917373, 39251712
Leukemia Myelomonocytic Chronic	Associate	12239142, 30334354
Leukemia Plasma Cell	Associate	35212134
Leukemia Prolymphocytic T Cell	Associate	29352181, 35655388, 9827924
Leukemia T Cell	Associate	1672451, 26814163, 37917373
Lichen Planus	Associate	37317627
Lichen Planus Oral	Associate	37317627
Liver Cirrhosis	Associate	35159124
Liver Cirrhosis Biliary	Associate	21735469, 7851017
Liver Cirrhosis Biliary	Stimulate	40596471
Lown Ganong Levine Syndrome	Stimulate	33475152
Lung Diseases	Associate	8137547
Lung Diseases Interstitial	Stimulate	10607488
Lung Neoplasms	Associate	2479079, 30774636, 35711455
Lupus Erythematosus Discoid	Associate	10598756
Lupus Erythematosus Systemic	Associate	15103684, 17195233, 25098715, 27718235, 29437559, 30009168, 30662367, 34952359, 37238593, 39743791, 7531628, 8100746, 9218819
Lupus Erythematosus Systemic	Stimulate	22506043, 31616406, 33475152, 33777025
Lupus Nephritis	Associate	36430418
Lymphangiectasis Intestinal	Inhibit	9862365
Lymphatic Metastasis	Associate	34160385
Lymphohistiocytosis Hemophagocytic	Associate	7851014
Lymphoma	Associate	10803703, 11473470, 12890821, 31481510, 7961877, 8695812, 9711895
Lymphoma AIDS Related	Associate	9056740
Lymphoma B Cell	Associate	11754202, 22961721, 34608246, 37651540
Lymphoma B Cell	Stimulate	26084540, 32485117
Lymphoma B Cell Marginal Zone	Associate	18500740, 30720103, 32963045
Lymphoma Follicular	Associate	15963046, 2960856
Lymphoma Large B Cell Diffuse	Associate	12588355, 23065155
Lymphoma Large Cell Anaplastic	Associate	18620733, 19123736
Lymphoma Mantle Cell	Associate	11754202, 2960856
Lymphoma Non Hodgkin	Associate	22961721, 26084540, 2960856
Lymphoma Non Hodgkin	Inhibit	27797254
Lymphoma T Cell	Associate	28943543
Lymphoma T Cell	Stimulate	2963547
Lymphoma T Cell Cutaneous	Associate	10433941, 2527911, 34608214, 8721488
Lymphoma T Cell Peripheral	Associate	20016960
Lymphopenia	Inhibit	10606975, 37279717
Lymphopenia	Associate	9008288
Lymphopenic Hypergammaglobulinemia Antibody Deficiency Autoimmune Hemolytic Anemia and Glomerulonephritis	Associate	10403927
Malnutrition	Associate	11737063
Mast Cell Activation Disorders	Associate	30975542, 7524750
Mast Cell Activation Syndrome	Associate	35281031
Mastitis	Associate	39399489
Mastocytosis Systemic	Associate	30975542
Maturity Onset Diabetes of the Young Type 8 with Exocrine Dysfunction	Associate	35498402
Medulloblastoma	Associate	25313399
Melanoma	Associate	19779716, 20882037, 21698244, 29546435, 30728070, 35962880, 37229623, 37996489
Melanoma Cutaneous Malignant	Associate	36032150, 37996489
Mesothelioma Malignant	Associate	34987640
Monoclonal Gammopathy of Undetermined Significance	Associate	8704185
Movement Disorders	Associate	28754092
Mpox (monkeypox)	Associate	36356606
Mucocutaneous Lymph Node Syndrome	Associate	9486410
Multi centric Castleman's Disease	Associate	18000163
Multiple Myeloma	Associate	10233376, 10929035, 11380472, 11877294, 12001122, 15470037, 15626731, 15741217, 16410445, 16951388, 17823079, 1830500, 18537967, 19165200, 20652971 View all (11 more)
Multiple Sclerosis	Associate	12810785, 12820694, 17903220, 21067621, 21437244, 22768094, 24842963, 26829210
Muscular Dystrophy Duchenne	Associate	24843230
Myasthenia Gravis	Associate	14575152, 15049785, 21482872
Myasthenia Gravis Autoimmune Experimental	Associate	12820694
Mycosis Fungoides	Associate	1828937, 2137847
Myelodysplastic Myeloproliferative Diseases	Associate	33369070
Myelodysplastic Syndromes	Associate	22315489, 23281097, 23475532, 27683035, 33369070, 35088567, 37933409
Myositis Inclusion Body	Associate	32259312
Narcolepsy 1	Associate	28107375
Nasal Polyps	Associate	25469646, 33819512
Nasopharyngeal Carcinoma	Associate	32690665, 35169126
Neoplasm Metastasis	Associate	18630512, 28282802, 28629469, 32554608
Neoplasm Residual	Associate	23911702
Neoplasms	Associate	10656748, 12116341, 12456216, 12483012, 15113392, 16371631, 1647137, 17699795, 18230189, 1828937, 19883432, 20665489, 20734397, 21054833, 21595914 View all (72 more)
Neoplasms	Inhibit	22438252, 34160385
Neoplasms Adipose Tissue	Stimulate	39769193
Neoplasms Cystic Mucinous and Serous	Associate	19641607
Neoplasms Plasma Cell	Associate	12714489
Neoplasms Squamous Cell	Associate	26299617, 33479027, 34529129
Neoplastic Cells Circulating	Associate	26961140, 27066900
Neuroblastoma	Associate	18630512, 32514618, 36571449
Neuroendocrine Tumors	Associate	32506804
Neuroinflammatory Diseases	Associate	17107594
Neuromyelitis Optica	Associate	37863660
Nijmegen Breakage Syndrome	Associate	14632755
Non alcoholic Fatty Liver Disease	Associate	29771426, 35790963
Obesity	Stimulate	28320058, 29549282
Obesity	Associate	39868576
Osteoarthritis	Associate	21953087, 32245507, 35008858, 37973964
Osteoarthritis Hip	Associate	37731506
Osteoporosis	Associate	36199280
Ovarian Neoplasms	Associate	10682675, 27259477, 27527602, 28589429, 32249277, 33062717, 33955198, 37800814, 7648722
Panic Disorder	Associate	12715014
Paraparesis Tropical Spastic	Associate	17483473
Paraproteinemias	Associate	24462038
Parkinson Disease	Associate	25644063, 26889637, 30248063
Paroxysmal nonkinesigenic dyskinesia	Associate	30614203
Periodontitis	Associate	7685315
Peripheral Arterial Disease	Stimulate	26324152
Peritoneal Neoplasms	Associate	33269456
Plasmacytoma	Associate	36735715
Plasmacytoma anaplastic	Associate	22182738
Pleural Effusion	Associate	21595914
Pleural Effusion Malignant	Associate	32867034
Poliomyelitis	Associate	26271191
Polyps	Associate	30720103
Pre Eclampsia	Associate	26285098
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	10210325
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	1531305
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16184615, 23911702, 26415521, 27598971, 40076625, 7664187
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19016721, 21323873, 22438252, 26814163, 27748273, 35778917, 37651540
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	23911702
Primary Immunodeficiency Diseases	Associate	31572362
Prodromal Symptoms	Associate	19779716
Prostatic Neoplasms	Associate	35286517
Prostatic Neoplasms Castration Resistant	Associate	35286517
Prostatitis	Associate	23038706
Proteinuria	Associate	34569195
Pseudolymphoma	Associate	35812422, 35989518
Psoriasis	Associate	34122426
Pulmonary Disease Chronic Obstructive	Stimulate	19229703
Pulmonary Disease Chronic Obstructive	Associate	35740993, 36127695
Pulpitis	Associate	39346909
Purpura Thrombocytopenic Idiopathic	Associate	26287565, 36202780
Purpura Thrombocytopenic Idiopathic	Inhibit	8400263
Pyruvate Carboxylase Deficiency Disease	Associate	22182738
Rectal Neoplasms	Associate	34160385
Renal Artery Obstruction	Inhibit	38031731
Renal Insufficiency Chronic	Associate	38174742
Respiratory Tract Diseases	Associate	40234829
Ring Chromosomes	Associate	12239142
Salivary Gland Diseases	Associate	9038756
Sarcoidosis	Associate	2143321, 26376720, 37373490, 8137547
Sarcoidosis Pulmonary	Associate	8137547
Sarcoma Ewing	Associate	19711435, 24498265
Sarcoma Myeloid	Associate	26415521
Scleroderma Systemic	Associate	17903220, 8484693
Seminoma	Associate	31545448
Sepsis	Associate	9697980
Severe Acute Respiratory Syndrome	Associate	28426727
Severe Combined Immunodeficiency	Associate	12716971, 22689986, 35303369, 9068311
Sezary Syndrome	Associate	11168816, 20801618, 28489605
Sjogren's Syndrome	Stimulate	10446867, 33777025
Sjogren's Syndrome	Associate	1720300, 24574234
Skin Diseases	Associate	1673877, 27764137
Smoldering Multiple Myeloma	Associate	8704185
Soft Tissue Injuries	Associate	28320058
Spinal Cord Diseases	Associate	17483473
Splenomegaly	Associate	27188997
Squamous Cell Carcinoma of Head and Neck	Associate	12610507, 24761979, 28282802, 28551813, 35514301, 36319566
Stomach Neoplasms	Associate	16175399, 27409423, 36640052, 38232734
Stroke	Associate	39706358
Supranuclear Palsy Progressive	Inhibit	30248063
Tertiary Lymphoid Structures	Associate	32963045
Tetany	Associate	26271191
Thymoma	Associate	12820694, 14575152
Thymus Neoplasms	Associate	7800006
Thyroid Cancer Papillary	Associate	17699795
Thyroid Neoplasms	Associate	17699795, 34456184
Thyroiditis Autoimmune	Stimulate	18637101
Thyroiditis Autoimmune	Associate	8695812
Toxoplasmosis Ocular	Associate	23100559
Triple Negative Breast Neoplasms	Associate	31787032, 34906209, 37593677
Tuberculosis	Associate	23555576, 26047476, 27553411
Tuberculosis Meningeal	Associate	34007850
Tuberculosis Pleural	Associate	21711347
Tuberculosis Pulmonary	Associate	12519392
Ulcer	Associate	15988806
Uniparental Disomy	Associate	22689986
Urinary Bladder Neoplasms	Associate	40159545
Uterine Cervical Neoplasms	Stimulate	33888832
Uterine Cervicitis	Associate	12519392, 33888832
Varicella Zoster Virus Infection	Associate	8340752
Vasculitis	Associate	19381293
Virus Diseases	Associate	21179445, 36127695, 9697980
Vitamin D Deficiency	Associate	25984539
Whooping Cough	Associate	25787136
Wiskott Aldrich Syndrome	Stimulate	8918565
X Linked Combined Immunodeficiency Diseases	Associate	12594301, 22689986, 32691468

PTPRC (protein tyrosine phosphatase receptor type C)