Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57823
Gene name Gene Name - the full gene name approved by the HGNC.
SLAM family member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLAMF7
Synonyms (NCBI Gene) Gene synonyms aliases
19A, CD319, CRACC, CS1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1351495 hsa-miR-1 CLIP-seq
MIRT1351496 hsa-miR-1273f CLIP-seq
MIRT1351497 hsa-miR-206 CLIP-seq
MIRT1351498 hsa-miR-3128 CLIP-seq
MIRT1351499 hsa-miR-3149 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005886 Component Plasma membrane TAS
GO:0006955 Process Immune response IBA
GO:0007155 Process Cell adhesion NAS 11802771
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606625 21394 ENSG00000026751
Protein
UniProt ID Q9NQ25
Protein name SLAM family member 7 (CD2 subset 1) (CD2-like receptor-activating cytotoxic cells) (CRACC) (Membrane protein FOAP-12) (Novel Ly9) (Protein 19A) (CD antigen CD319)
Protein function Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-ce
Sequence
MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPL
VTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEY
VLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSIL
PISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSL
FVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA
NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cervical Cancer Cervical cancer N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Angina Pectoris Associate 26823790
Arthritis Rheumatoid Associate 35148199
Asthma Associate 34510493
Atherosclerosis Associate 29905534
Carcinoma Renal Cell Associate 23139634
Carcinoma Squamous Cell Associate 24130905, 28211524
Carotid Artery Diseases Associate 29905534
Colitis Ulcerative Associate 33201212, 38303405
Colorectal Neoplasms Associate 30918427
Congenital thrombotic disease due to Protein C deficiency Associate 26666746, 27109862