Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57823
Gene name Gene Name - the full gene name approved by the HGNC.	SLAM family member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLAMF7
Synonyms (NCBI Gene) Gene synonyms aliases	19A, CD319, CRACC, CS1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.3

Show/Hide all(108)

miRTarBase ID	miRNA	Experiments
MIRT1351495	hsa-miR-1	CLIP-seq
MIRT1351496	hsa-miR-1273f	CLIP-seq
MIRT1351497	hsa-miR-206	CLIP-seq
MIRT1351498	hsa-miR-3128	CLIP-seq
MIRT1351499	hsa-miR-3149	CLIP-seq
MIRT1351500	hsa-miR-3170	CLIP-seq
MIRT1351501	hsa-miR-3200-3p	CLIP-seq
MIRT1351502	hsa-miR-33a	CLIP-seq
MIRT1351503	hsa-miR-33b	CLIP-seq
MIRT1351504	hsa-miR-3673	CLIP-seq
MIRT1351505	hsa-miR-3682-5p	CLIP-seq
MIRT1351506	hsa-miR-411	CLIP-seq
MIRT1351507	hsa-miR-4263	CLIP-seq
MIRT1351508	hsa-miR-4292	CLIP-seq
MIRT1351509	hsa-miR-450b-3p	CLIP-seq
MIRT1351510	hsa-miR-4720-5p	CLIP-seq
MIRT1351511	hsa-miR-4738-3p	CLIP-seq
MIRT1351512	hsa-miR-4799-3p	CLIP-seq
MIRT1351513	hsa-miR-508-5p	CLIP-seq
MIRT1351514	hsa-miR-5095	CLIP-seq
MIRT1351515	hsa-miR-545	CLIP-seq
MIRT1351516	hsa-miR-552	CLIP-seq
MIRT1351517	hsa-miR-574-3p	CLIP-seq
MIRT1351518	hsa-miR-613	CLIP-seq
MIRT1351519	hsa-miR-764	CLIP-seq
MIRT1351520	hsa-miR-769-3p	CLIP-seq
MIRT2104181	hsa-miR-1245b-3p	CLIP-seq
MIRT2104182	hsa-miR-1915	CLIP-seq
MIRT2104183	hsa-miR-3187-3p	CLIP-seq
MIRT2104184	hsa-miR-3545-3p	CLIP-seq
MIRT2104185	hsa-miR-3663-5p	CLIP-seq
MIRT2104186	hsa-miR-4330	CLIP-seq
MIRT2104187	hsa-miR-4435	CLIP-seq
MIRT2104188	hsa-miR-4635	CLIP-seq
MIRT2104189	hsa-miR-4680-5p	CLIP-seq
MIRT2104190	hsa-miR-4701-5p	CLIP-seq
MIRT2104191	hsa-miR-4716-5p	CLIP-seq
MIRT2104192	hsa-miR-4726-3p	CLIP-seq
MIRT2104193	hsa-miR-4755-3p	CLIP-seq
MIRT2104194	hsa-miR-4757-5p	CLIP-seq
MIRT2104195	hsa-miR-4772-3p	CLIP-seq
MIRT2104196	hsa-miR-4781-3p	CLIP-seq
MIRT2104197	hsa-miR-498	CLIP-seq
MIRT2104198	hsa-miR-5096	CLIP-seq
MIRT2104199	hsa-miR-532-5p	CLIP-seq
MIRT1351515	hsa-miR-545	CLIP-seq
MIRT2104200	hsa-miR-548s	CLIP-seq
MIRT1351517	hsa-miR-574-3p	CLIP-seq
MIRT2104201	hsa-miR-588	CLIP-seq
MIRT2328308	hsa-miR-106a	CLIP-seq
MIRT2328309	hsa-miR-106b	CLIP-seq
MIRT2328310	hsa-miR-1295	CLIP-seq
MIRT2328311	hsa-miR-149	CLIP-seq
MIRT2328312	hsa-miR-150	CLIP-seq
MIRT2328313	hsa-miR-17	CLIP-seq
MIRT2104182	hsa-miR-1915	CLIP-seq
MIRT2328314	hsa-miR-20a	CLIP-seq
MIRT2328315	hsa-miR-20b	CLIP-seq
MIRT2328316	hsa-miR-24	CLIP-seq
MIRT2328317	hsa-miR-302a	CLIP-seq
MIRT2328318	hsa-miR-302b	CLIP-seq
MIRT2328319	hsa-miR-302c	CLIP-seq
MIRT2328320	hsa-miR-302d	CLIP-seq
MIRT2328321	hsa-miR-302e	CLIP-seq
MIRT2328322	hsa-miR-3064-5p	CLIP-seq
MIRT2328323	hsa-miR-3135	CLIP-seq
MIRT2104183	hsa-miR-3187-3p	CLIP-seq
MIRT2328324	hsa-miR-372	CLIP-seq
MIRT2328325	hsa-miR-373	CLIP-seq
MIRT2328326	hsa-miR-3934	CLIP-seq
MIRT2328327	hsa-miR-4284	CLIP-seq
MIRT2328328	hsa-miR-4423-5p	CLIP-seq
MIRT2104187	hsa-miR-4435	CLIP-seq
MIRT2104190	hsa-miR-4701-5p	CLIP-seq
MIRT2104191	hsa-miR-4716-5p	CLIP-seq
MIRT2104192	hsa-miR-4726-3p	CLIP-seq
MIRT2328329	hsa-miR-4731-5p	CLIP-seq
MIRT2328330	hsa-miR-4743	CLIP-seq
MIRT2104193	hsa-miR-4755-3p	CLIP-seq
MIRT2104194	hsa-miR-4757-5p	CLIP-seq
MIRT2104195	hsa-miR-4772-3p	CLIP-seq
MIRT2328331	hsa-miR-4774-3p	CLIP-seq
MIRT2104196	hsa-miR-4781-3p	CLIP-seq
MIRT2328332	hsa-miR-4794	CLIP-seq
MIRT2104197	hsa-miR-498	CLIP-seq
MIRT1351514	hsa-miR-5095	CLIP-seq
MIRT2328333	hsa-miR-512-3p	CLIP-seq
MIRT2328334	hsa-miR-519d	CLIP-seq
MIRT2328335	hsa-miR-520a-3p	CLIP-seq
MIRT2328336	hsa-miR-520b	CLIP-seq
MIRT2328337	hsa-miR-520c-3p	CLIP-seq
MIRT2328338	hsa-miR-520d-3p	CLIP-seq
MIRT2328339	hsa-miR-520e	CLIP-seq
MIRT2328340	hsa-miR-520g	CLIP-seq
MIRT2328341	hsa-miR-520h	CLIP-seq
MIRT2104199	hsa-miR-532-5p	CLIP-seq
MIRT2104200	hsa-miR-548s	CLIP-seq
MIRT1351516	hsa-miR-552	CLIP-seq
MIRT1351517	hsa-miR-574-3p	CLIP-seq
MIRT2104201	hsa-miR-588	CLIP-seq
MIRT1351519	hsa-miR-764	CLIP-seq
MIRT2328342	hsa-miR-93	CLIP-seq
MIRT2394596	hsa-miR-219-2-3p	CLIP-seq
MIRT2104182	hsa-miR-1915	CLIP-seq
MIRT2104192	hsa-miR-4726-3p	CLIP-seq
MIRT2104197	hsa-miR-498	CLIP-seq
MIRT2623082	hsa-miR-500a	CLIP-seq
MIRT2104199	hsa-miR-532-5p	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	NAS	11802771
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030101	Process	Natural killer cell activation	NAS	11698418
GO:0042110	Process	T cell activation	IBA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	NAS	11698418
GO:0042802	Function	Identical protein binding	IPI	15153464, 21982860
GO:0045087	Process	Innate immune response	IEA

MIM	HGNC	e!Ensembl
606625	21394	ENSG00000026751

Protein

UniProt ID

Q9NQ25

Protein name

SLAM family member 7 (CD2 subset 1) (CD2-like receptor-activating cytotoxic cells) (CRACC) (Membrane protein FOAP-12) (Novel Ly9) (Protein 19A) (CD antigen CD319)

Protein function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-ce

Sequence

MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPL
VTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEY
VLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSIL
PISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSL
FVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA
NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI

Sequence length

335

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cervical Cancer	Cervical cancer	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Angina Pectoris	Associate	26823790
Arthritis Rheumatoid	Associate	35148199
Asthma	Associate	34510493
Atherosclerosis	Associate	29905534
Carcinoma Renal Cell	Associate	23139634
Carcinoma Squamous Cell	Associate	24130905, 28211524
Carotid Artery Diseases	Associate	29905534
Colitis Ulcerative	Associate	33201212, 38303405
Colorectal Neoplasms	Associate	30918427
Congenital thrombotic disease due to Protein C deficiency	Associate	26666746, 27109862
COVID 19	Associate	35148199
Crohn Disease	Associate	33201212, 35148199
Heavy Chain Disease	Associate	32826957
HIV Infections	Associate	30530590
Immunoglobulin G4 Related Disease	Stimulate	29499100
Inflammation	Associate	28678593, 35148199
Inflammatory Bowel Diseases	Associate	33201212
Leukemia Lymphocytic Chronic B Cell	Associate	32826957
Leukemia Plasma Cell	Associate	26130131, 26666746
Lupus Erythematosus Systemic	Associate	20345977, 23956418, 33828555
Lupus Erythematosus Systemic	Inhibit	28076903, 29020082
Meningitis Pneumococcal	Associate	34620928
Multiple Myeloma	Associate	23900284, 24385542, 26666746, 29089645, 30519736, 31431433, 33575947, 33846552, 35276027, 36245253, 38035078
Multiple Sclerosis	Associate	36864689, 37903821
Myocardial Infarction	Inhibit	26823790
Neoplasm Residual	Associate	26287276
Neoplasms	Associate	28222938, 29089645, 30710089, 36357792
Neuroblastoma	Associate	35525858
Otitis Media	Stimulate	39921981
Ovarian Neoplasms	Associate	32149080, 36978087
Pleural Effusion	Associate	21123535
Pneumonia	Associate	39921981
Pneumonia Pneumococcal	Associate	21123535, 30388168
Psoriasis	Associate	38303405
Pyruvate Carboxylase Deficiency Disease	Associate	36752202
Sarcoma Myeloid	Associate	33575947
Skin Neoplasms	Associate	28211524
Virus Diseases	Associate	28076903

SLAMF7 (SLAM family member 7)