Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57818
Gene name Gene Name - the full gene name approved by the HGNC.
Glucose-6-phosphatase catalytic subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
G6PC2
Synonyms (NCBI Gene) Gene synonyms aliases
IGRP
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an enzyme belonging to the glucose-6-phosphatase catalytic subunit family. These enzymes are part of a multicomponent integral membrane system that catalyzes the hydrolysis of glucose-6-phosphate, the terminal step in gluconeogenic and g
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT440599 hsa-miR-377-5p HITS-CLIP 24374217
MIRT440598 hsa-miR-409-3p HITS-CLIP 24374217
MIRT440599 hsa-miR-377-5p HITS-CLIP 24374217
MIRT440598 hsa-miR-409-3p HITS-CLIP 24374217
MIRT1008910 hsa-miR-1228 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004346 Function Glucose-6-phosphatase activity EXP 14722102
GO:0004346 Function Glucose-6-phosphatase activity IBA
GO:0004346 Function Glucose-6-phosphatase activity IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608058 28906 ENSG00000152254
Protein
UniProt ID Q9NQR9
Protein name Glucose-6-phosphatase 2 (G-6-Pase 2) (G6Pase 2) (EC 3.1.3.9) (Islet-specific glucose-6-phosphatase catalytic subunit-related protein)
Protein function May hydrolyze glucose-6-phosphate to glucose in the endoplasmic reticulum. May be responsible for glucose production through glycogenolysis and gluconeogenesis (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 53 197 PAP2 superfamily Family
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in pancreas and also detected to a lower extent in testis. Expressed by most islet cells in the pancreas (at protein level). {ECO:0000269|PubMed:11297555}.
Sequence
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTP
GIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Carbohydrate digestion and absorption
  Gluconeogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 31246991
Diabetes Mellitus Associate 20357361, 27322064
Diabetes Mellitus Type 1 Associate 28566371, 36961507
Diabetes Mellitus Type 2 Associate 19533084, 19669124, 20628598, 20668700, 25631608, 29621232, 30055620, 35657990
Glioblastoma Associate 33553434
Hypoglycemia Associate 19669124
Insulin Resistance Associate 20628598
Neoplasms Inhibit 34222480
Obesity Associate 26132169
Opitz Kaveggia syndrome Associate 25631608