Gene Gene information from NCBI Gene database.
Entrez ID 57818
Gene name Glucose-6-phosphatase catalytic subunit 2
Gene symbol G6PC2
Synonyms (NCBI Gene)
IGRP
Chromosome 2
Chromosome location 2q31.1
Summary This gene encodes an enzyme belonging to the glucose-6-phosphatase catalytic subunit family. These enzymes are part of a multicomponent integral membrane system that catalyzes the hydrolysis of glucose-6-phosphate, the terminal step in gluconeogenic and g
miRNA miRNA information provided by mirtarbase database.
90
miRTarBase ID miRNA Experiments Reference
MIRT440599 hsa-miR-377-5p HITS-CLIP 24374217
MIRT440598 hsa-miR-409-3p HITS-CLIP 24374217
MIRT440599 hsa-miR-377-5p HITS-CLIP 24374217
MIRT440598 hsa-miR-409-3p HITS-CLIP 24374217
MIRT1008910 hsa-miR-1228 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0004346 Function Glucose-6-phosphatase activity EXP 14722102
GO:0004346 Function Glucose-6-phosphatase activity IBA
GO:0004346 Function Glucose-6-phosphatase activity IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608058 28906 ENSG00000152254
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NQR9
Protein name Glucose-6-phosphatase 2 (G-6-Pase 2) (G6Pase 2) (EC 3.1.3.9) (Islet-specific glucose-6-phosphatase catalytic subunit-related protein)
Protein function May hydrolyze glucose-6-phosphate to glucose in the endoplasmic reticulum. May be responsible for glucose production through glycogenolysis and gluconeogenesis (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 53 197 PAP2 superfamily Family
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in pancreas and also detected to a lower extent in testis. Expressed by most islet cells in the pancreas (at protein level). {ECO:0000269|PubMed:11297555}.
Sequence
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTP
GIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Carbohydrate digestion and absorption
  Gluconeogenesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Fasting plasma glucose level quantitative trait locus 1 Uncertain significance rs146779637 RCV000662011
G6PC2-related disorder Likely benign; Benign rs2232324, rs2232328, rs181737385, rs2232326, rs144077223 RCV003929611
RCV003974389
RCV003914392
RCV003939404
RCV003932240
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 31246991
Diabetes Mellitus Associate 20357361, 27322064
Diabetes Mellitus Type 1 Associate 28566371, 36961507
Diabetes Mellitus Type 2 Associate 19533084, 19669124, 20628598, 20668700, 25631608, 29621232, 30055620, 35657990
Glioblastoma Associate 33553434
Hypoglycemia Associate 19669124
Insulin Resistance Associate 20628598
Neoplasms Inhibit 34222480
Obesity Associate 26132169
Opitz Kaveggia syndrome Associate 25631608