Gene Gene information from NCBI Gene database.
Entrez ID 578
Gene name BCL2 antagonist/killer 1
Gene symbol BAK1
Synonyms (NCBI Gene)
BAKBAK-LIKEBCL2L7CDN1
Chromosome 6
Chromosome location 6p21.31
Summary The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mito
miRNA miRNA information provided by mirtarbase database.
501
miRTarBase ID miRNA Experiments Reference
MIRT005350 hsa-miR-125a-5p FlowLuciferase reporter assayqRT-PCRWestern blot 20616003
MIRT002394 hsa-miR-125b-5p Luciferase reporter assayqRT-PCRWestern blot 18056640
MIRT002394 hsa-miR-125b-5p Luciferase reporter assayqRT-PCRWestern blot 21823019
MIRT002394 hsa-miR-125b-5p Luciferase reporter assayqRT-PCRWestern blot 21823019
MIRT002394 hsa-miR-125b-5p Luciferase reporter assayqRT-PCRWestern blot 21823019
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
WWTR1 Activation 22470139
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
111
GO ID Ontology Definition Evidence Reference
GO:0001776 Process Leukocyte homeostasis IEA
GO:0001782 Process B cell homeostasis IEA
GO:0001783 Process B cell apoptotic process IEA
GO:0001836 Process Release of cytochrome c from mitochondria IBA
GO:0001836 Process Release of cytochrome c from mitochondria IDA 9843949, 16199525
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600516 949 ENSG00000030110
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16611
Protein name Bcl-2 homologous antagonist/killer (Apoptosis regulator BAK) (Bcl-2-like protein 7) (Bcl2-L-7)
Protein function Plays a role in the mitochondrial apoptotic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytos
PDB 1BXL , 2IMS , 2IMT , 2JBY , 2JCN , 2LP8 , 2M5B , 2XPX , 2YV6 , 3I1H , 3QBR , 4D2L , 4U2U , 4U2V , 4UF1 , 5AJK , 5FMI , 5FMK , 5VWV , 5VWW , 5VWX , 5VWY , 5VWZ , 5VX0 , 5VX1 , 6ODH , 6UXM , 6UXN , 6UXO , 6UXP , 6UXQ , 6UXR , 7K02 , 7LK4 , 7M5A , 7M5B , 7OFM , 7OFO , 8CZF , 8CZG , 8CZH , 8GSV , 8IGC , 8IVB , 8SRX , 8SRY , 8UKY , 8Y1Y , 8Y1Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00452 Bcl-2 78 177 Apoptosis regulator proteins, Bcl-2 family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
Sequence
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGW
VAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Sequence length 211
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Platinum drug resistance
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Pathways of neurodegeneration - multiple diseases
Pathogenic Escherichia coli infection
Salmonella infection
Hepatitis C
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
  Activation and oligomerization of BAK protein
Release of apoptotic factors from the mitochondria