Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57728
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR19
Synonyms (NCBI Gene) Gene synonyms aliases
ATD5, CED4, CFAP66, DYF-2, FAP66, IFT144, NPHP13, ORF26, Oseg6, PWDMP, SPGF72, SRTD5
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p14
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the WD (tryptophan-aspartic acid) repeat family, which is a large family of structurally-related proteins known to participate in a wide range of cellular processes. Each WD repeat typically contains about 4
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs76599296 C>G Conflicting-interpretations-of-pathogenicity Missense variant, non coding transcript variant, coding sequence variant
rs79436363 G>A Pathogenic, uncertain-significance, pathogenic-likely-pathogenic Missense variant, genic downstream transcript variant, non coding transcript variant, coding sequence variant
rs141039852 G>A,C Conflicting-interpretations-of-pathogenicity Missense variant, genic downstream transcript variant, non coding transcript variant, coding sequence variant
rs187546086 A>C Uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs199904529 G>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017813 hsa-miR-335-5p Microarray 18185580
MIRT049394 hsa-miR-92a-3p CLASH 23622248
MIRT1489821 hsa-miR-1185 CLIP-seq
MIRT1489822 hsa-miR-132 CLIP-seq
MIRT1489823 hsa-miR-148a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IEA
GO:0001701 Process In utero embryonic development IEA
GO:0001750 Component Photoreceptor outer segment IEA
GO:0005515 Function Protein binding IPI 27173435, 27932497, 28514442, 29220510, 33961781
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608151 18340 ENSG00000157796
Protein
UniProt ID Q8NEZ3
Protein name WD repeat-containing protein 19 (Intraflagellar transport 144 homolog)
Protein function As component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs), it is involved in cilia function and/or assembly (PubMed:20889716). Essential for functio
PDB 8BBF , 8BBG , 8FGW , 8FH3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15911 WD40_3 508 564 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Some isoforms are tissue-specific. Highly expressed in the prostate. Lower expression in the cerebellum, pituitary gland, fetal lung, and pancreas. In normal prostate, expressed in both basal and luminal epithelial cells. No expression
Sequence
MKRIFSLLEKTWLGAPIQFAWQKTSGNYLAVTGADYIVKIFDRHGQKRSEINLPGNCVAM
DWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKGN
LLIYNHQTSRKIPVLGKHTKRITCGCWNAENLLALGGEDKMITVSNQEGDTIRQTQVRSE
PSNMQFFLMKMDDRTSAAESMISVVLGKKTLFFLNLNEPDNPADLEFQQDFGNIVCYNWY
GDGRIMIGFSCGHFVVISTHTGELGQEIFQARNHKDNLTSIAVSQTLNKVATCGDNCIKI
QDLVDLKDMYVILNLDEENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKLPILGDACSTR
IAYLTSLLEVTVANPVEGELPITVSVDVEPNFVAVGLYHLAVGMNNRAWFYVLGENAVKK
LKDMEYLGTVASICLHSDYAAALFEGKVQLHLIESEILDAQEERETRLFPAVDDKCRILC
HALTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSVKKIFPDPNGTRLVFIDEKSDGFV
YCPVNDATYEIPDFSPTIKGVLWE
NWPMDKGVFIAYDDDKVYTYVFHKDTIQGAKVILAG
STKVPFAHKPLLLYNGELTCQTQSGKVNNIYLSTHGFLSNLKDTGPDELRPMLAQNLMLK
RFSDAWEMCRILNDEAAWNELARACLHHMEVEFAIRVYRRIGNVGIVMSLEQIKGIEDYN
LLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQHWDSALQLAKHLAPDQIPFISKE
YAIQLEFAGDYVNALAHYEKGITGDNKEHDEACLAGVAQMSIRMGDIRRGVNQALKHPSR
VLKRDCGAILENMKQFSEAAQLYEKGLYYDKAASVYIRSKNWAKVGDLLPHVSSPKIHLQ
YAKAKEADGRYKEAVVAYENAKQWQSVIRIYLDHLNNPEKAVNIVRETQSLDGAKMVARF
FLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKMEIYADIIGSEDTTNEDYQSIALYFEGE
KRYLQAGKFFLLCGQYSRALKHFLKCPSSEDNVAIEMAIETVGQAKDELLTNQLIDHLLG
ENDGMPKDAKYLFRLYMALKQYREAAQTAIIIAREEQSAGNYRNAHDVLFSMYAELKSQK
IKIPSEMATNLMILHSYILVKIHVKNGDHMKGARMLIRVANNISKFPSHIVPILTSTVIE
CHRAGLKNSAFSFAAMLMRPEYRSKIDAKYKKKIEGMVRRPDISEIEEATTPCPFCKFLL
PECELLCPGCKNSIPYCIATGRHMLKDDWTVCPHCDFPALYSELKIMLNTESTCPMCSER
LNAAQLKKISDCTQYLRTEEEL
Sequence length 1342
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Hedgehog 'off' state
Intraflagellar transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Asphyxiating Thoracic Dystrophy Asphyxiating thoracic dystrophy 5 rs1577822861, rs1327583103, rs387906982, rs387906980 N/A
Connective Tissue Disease Connective tissue disorder rs387906980, rs587777352 N/A
Cranioectodermal Dysplasia cranioectodermal dysplasia 4 rs79436363, rs387906981, rs387906980, rs751290509 N/A
Jeune Thoracic Dystrophy jeune thoracic dystrophy rs1553905326, rs748656635, rs377160857, rs1215108056, rs587777352, rs772599282, rs1191056931, rs745603321, rs747165335 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bardet-Biedl Syndrome bardet-biedl syndrome N/A N/A ClinVar
craniosynostosis syndrome Craniosynostosis syndrome N/A N/A ClinVar
Glaucoma Glaucoma N/A N/A GWAS
Jeune Syndrome Jeune syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Caroli Disease Associate 23559409
Ciliopathies Associate 22019273, 23559409, 23683095, 32055034, 33875766, 34354814, 36833411, 38062428
Cranioectodermal Dysplasia Associate 22019273, 32007091
Down Syndrome Associate 36833411
general anxiety disorder Associate 36344488
Genetic Diseases Inborn Associate 36833411
Immune dysfunction with T cell inactivation due to calcium entry defect 2 Associate 38062428
Infertility Male Associate 32323121
Iridogoniodysgenesis and skeletal anomalies Associate 22019273
Jeune syndrome Associate 22019273, 31935347