Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57599
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 48
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR48
Synonyms (NCBI Gene) Gene synonyms aliases
Bun62, P80, SPG60, UAF1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p22.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene has been shown to interact with ubiquitin specific peptidase 1 (USP1), activating the deubiquitinating activity of USP1 and allowing it to remove the ubiquitin moiety from monoubiquitinated FANCD2. FANCD2 is ubiquitinated
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051598 hsa-let-7e-5p CLASH 23622248
MIRT044190 hsa-miR-99b-5p CLASH 23622248
MIRT1490813 hsa-miR-1305 CLIP-seq
MIRT1490814 hsa-miR-147 CLIP-seq
MIRT1490815 hsa-miR-2053 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000724 Process Double-strand break repair via homologous recombination IEA
GO:0003677 Function DNA binding IDA 31253762
GO:0003690 Function Double-stranded DNA binding IDA 27239033
GO:0003697 Function Single-stranded DNA binding IDA 27239033
GO:0005515 Function Protein binding IPI 18082604, 19075014, 24145035, 27239033, 27373336, 27463890, 27650958
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612167 30914 ENSG00000114742
Protein
UniProt ID Q8TAF3
Protein name WD repeat-containing protein 48 (USP1-associated factor 1) (WD repeat endosomal protein) (p80)
Protein function Regulator of deubiquitinating complexes, which acts as a strong activator of USP1, USP12 and USP46 (PubMed:18082604, PubMed:19075014, PubMed:26388029, PubMed:31253762). Enhances the USP1-mediated deubiquitination of FANCD2; USP1 being almost ina
PDB 5CVL , 5CVN , 5CVO , 5K1A , 5K1B , 5K1C , 5L8E , 5L8W , 6JLQ , 7AY0 , 7AY1 , 7AY2 , 8A9J , 8A9K , 9EBS , 9HNW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 66 103 WD domain, G-beta repeat Repeat
PF00400 WD40 107 145 WD domain, G-beta repeat Repeat
PF00400 WD40 158 196 WD domain, G-beta repeat Repeat
PF00400 WD40 200 238 WD domain, G-beta repeat Repeat
PF11816 DUF3337 509 674 Domain of unknown function (DUF3337) Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12196293}.
Sequence
MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVN
QHKQDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYV
KALAYAKDKELVASAGLDRQIFLWD
VNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLG
TIIVSGSTEKVLRVWD
PRTCAKLMKLKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLG
QQRCIATYRVHDEGVWALQVNDAFTHVYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLKM
ELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLCTQPDQVIKGG
ASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWF
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVN
PMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESM
LLNETVPQWVIDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHV
YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHF
IWKSGGDLTLHYRQ
KST
Sequence length 677
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Fanconi anemia pathway   Recognition of DNA damage by PCNA-containing replication complex
Ub-specific processing proteases
Fanconi Anemia Pathway
Signaling by cytosolic PDGFRA and PDGFRB fusion proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Mental retardation Mild Mental Retardation rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Nystagmus Nystagmus rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Spastic paraplegia Spastic Paraplegia, Autosomal recessive spastic paraplegia type 60 rs118204049, rs121918262, rs104894490, rs119476046, rs281865117, rs281865118, rs137853017, rs72554620, rs121908610, rs121908611, rs121908613, rs116171274, rs121434442, rs121434443, rs137852520
View all (368 more)
24482476
Unknown
Disease term Disease name Evidence References Source
Spastic Paraplegia autosomal recessive spastic paraplegia type 60 GenCC
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 36403194
Carcinoma Non Small Cell Lung Associate 22118673, 25229643
Colorectal Neoplasms Associate 24145035
Drug Hypersensitivity Associate 27239033
Fanconi Anemia Associate 18082604, 19075014, 20147737, 22118673, 30890612, 31253762, 32350107, 33795880
Intracranial Aneurysm Associate 26186006
Neoplasm Metastasis Associate 36403194
Neoplasms Associate 22701671, 24145035, 32951278
Prostatic Neoplasms Associate 26462181
Triple Negative Breast Neoplasms Associate 33461373