RPTOR (regulatory associated protein of MTOR complex 1)

Gene

• Entrez ID: 57521
• Gene name: Regulatory associated protein of MTOR complex 1
• Gene symbol: RPTOR
• Synonyms (NCBI Gene): KOG1, Mip1
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050023	hsa-miR-27a-3p	CLASH	23622248
MIRT046186	hsa-miR-27b-3p	CLASH	23622248
MIRT1319074	hsa-miR-1225-3p	CLIP-seq
MIRT1319075	hsa-miR-125a-5p	CLIP-seq
MIRT1319076	hsa-miR-125b	CLIP-seq
MIRT1319077	hsa-miR-129-3p	CLIP-seq
MIRT1319078	hsa-miR-1908	CLIP-seq
MIRT1319079	hsa-miR-2278	CLIP-seq
MIRT1319080	hsa-miR-23a	CLIP-seq
MIRT1319081	hsa-miR-23b	CLIP-seq
MIRT1319082	hsa-miR-23c	CLIP-seq
MIRT1319083	hsa-miR-2861	CLIP-seq
MIRT1319084	hsa-miR-3064-5p	CLIP-seq
MIRT1319085	hsa-miR-3127-3p	CLIP-seq
MIRT1319086	hsa-miR-3144-5p	CLIP-seq
MIRT1319087	hsa-miR-3151	CLIP-seq
MIRT1319088	hsa-miR-3153	CLIP-seq
MIRT1319089	hsa-miR-3180	CLIP-seq
MIRT1319090	hsa-miR-3180-3p	CLIP-seq
MIRT1319091	hsa-miR-3180-5p	CLIP-seq
MIRT1319092	hsa-miR-3186-3p	CLIP-seq
MIRT1319093	hsa-miR-3191	CLIP-seq
MIRT1319094	hsa-miR-3196	CLIP-seq
MIRT1319095	hsa-miR-323-3p	CLIP-seq
MIRT1319096	hsa-miR-3652	CLIP-seq
MIRT1319097	hsa-miR-3937	CLIP-seq
MIRT1319098	hsa-miR-4270	CLIP-seq
MIRT1319099	hsa-miR-4319	CLIP-seq
MIRT1319100	hsa-miR-4417	CLIP-seq
MIRT1319101	hsa-miR-4430	CLIP-seq
MIRT1319102	hsa-miR-4437	CLIP-seq
MIRT1319103	hsa-miR-4441	CLIP-seq
MIRT1319104	hsa-miR-4447	CLIP-seq
MIRT1319105	hsa-miR-4472	CLIP-seq
MIRT1319106	hsa-miR-4488	CLIP-seq
MIRT1319107	hsa-miR-4505	CLIP-seq
MIRT1319108	hsa-miR-4641	CLIP-seq
MIRT1319109	hsa-miR-4651	CLIP-seq
MIRT1319110	hsa-miR-4652-5p	CLIP-seq
MIRT1319111	hsa-miR-4674	CLIP-seq
MIRT1319112	hsa-miR-4685-5p	CLIP-seq
MIRT1319113	hsa-miR-4690-3p	CLIP-seq
MIRT1319114	hsa-miR-4697-5p	CLIP-seq
MIRT1319115	hsa-miR-4731-5p	CLIP-seq
MIRT1319116	hsa-miR-4732-3p	CLIP-seq
MIRT1319117	hsa-miR-4746-3p	CLIP-seq
MIRT1319118	hsa-miR-4747-5p	CLIP-seq
MIRT1319119	hsa-miR-4781-5p	CLIP-seq
MIRT1319120	hsa-miR-4786-3p	CLIP-seq
MIRT1319121	hsa-miR-4786-5p	CLIP-seq
MIRT1319122	hsa-miR-486-3p	CLIP-seq
MIRT1319123	hsa-miR-491-5p	CLIP-seq
MIRT1319124	hsa-miR-520a-5p	CLIP-seq
MIRT1319125	hsa-miR-525-5p	CLIP-seq
MIRT1319126	hsa-miR-541	CLIP-seq
MIRT1319127	hsa-miR-608	CLIP-seq
MIRT1319128	hsa-miR-654-5p	CLIP-seq
MIRT1319129	hsa-miR-662	CLIP-seq
MIRT1319130	hsa-miR-663	CLIP-seq
MIRT1319131	hsa-miR-670	CLIP-seq
MIRT1319132	hsa-miR-671-5p	CLIP-seq
MIRT1319133	hsa-miR-885-3p	CLIP-seq
MIRT1553187	hsa-miR-149	CLIP-seq
MIRT1319120	hsa-miR-4786-3p	CLIP-seq
MIRT1319075	hsa-miR-125a-5p	CLIP-seq
MIRT1319076	hsa-miR-125b	CLIP-seq
MIRT1319080	hsa-miR-23a	CLIP-seq
MIRT1319081	hsa-miR-23b	CLIP-seq
MIRT1319082	hsa-miR-23c	CLIP-seq
MIRT1319083	hsa-miR-2861	CLIP-seq
MIRT1319084	hsa-miR-3064-5p	CLIP-seq
MIRT2094861	hsa-miR-3194-5p	CLIP-seq
MIRT1319096	hsa-miR-3652	CLIP-seq
MIRT1319099	hsa-miR-4319	CLIP-seq
MIRT2094862	hsa-miR-4323	CLIP-seq
MIRT1319101	hsa-miR-4430	CLIP-seq
MIRT2094863	hsa-miR-4449	CLIP-seq
MIRT1319107	hsa-miR-4505	CLIP-seq
MIRT2094864	hsa-miR-452	CLIP-seq
MIRT2094865	hsa-miR-4639-3p	CLIP-seq
MIRT2094866	hsa-miR-4676-3p	CLIP-seq
MIRT2094867	hsa-miR-4693-5p	CLIP-seq
MIRT1319126	hsa-miR-541	CLIP-seq
MIRT2094868	hsa-miR-619	CLIP-seq
MIRT1319128	hsa-miR-654-5p	CLIP-seq
MIRT2094869	hsa-miR-668	CLIP-seq
MIRT1319080	hsa-miR-23a	CLIP-seq
MIRT1319081	hsa-miR-23b	CLIP-seq
MIRT1319082	hsa-miR-23c	CLIP-seq
MIRT2458615	hsa-miR-1912	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
POU2F1	Unknown	21060808
RARA	Unknown	21060808

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0001558	Process	Regulation of cell growth	IMP	20381137
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0005515	Function	Protein binding	IPI	12150925, 12150926, 12408816, 17386266, 17461779, 17565979, 18337751, 18955708, 19446321, 19619545, 19875983, 20347422, 20543138, 20562859, 21045808, 21339740, 21471201, 21614075, 22424946, 23027611, 23263282, 23953116, 24036451, 24375676, 25446900, 25657994, 25686248, 25940091, 263
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20381137
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA	20381137
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	IMP	22424946
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	31601764
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006974	Process	DNA damage response	NAS	17041623
GO:0008361	Process	Regulation of cell size	IMP	12150925
GO:0009267	Process	Cellular response to starvation	IBA
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0010494	Component	Cytoplasmic stress granule	IDA	25940091
GO:0010506	Process	Regulation of autophagy	IBA
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010507	Process	Negative regulation of autophagy	NAS	28283069
GO:0010646	Process	Regulation of cell communication	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	18439900
GO:0023051	Process	Regulation of signaling	IEA
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	12718876
GO:0030295	Function	Protein kinase activator activity	IDA	12150926
GO:0030307	Process	Positive regulation of cell growth	IBA
GO:0030307	Process	Positive regulation of cell growth	IMP	18426977
GO:0030307	Process	Positive regulation of cell growth	NAS	25906254
GO:0030425	Component	Dendrite	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	12150926, 37541260
GO:0031267	Function	Small GTPase binding	IDA	26588989, 37541260
GO:0031669	Process	Cellular response to nutrient levels	IDA	29236692, 29750193, 31601708, 32561715
GO:0031669	Process	Cellular response to nutrient levels	IDA	12150926, 12747827, 32561715
GO:0031669	Process	Cellular response to nutrient levels	IMP	12150925
GO:0031669	Process	Cellular response to nutrient levels	NAS	19299511
GO:0031929	Process	TOR signaling	IDA	20381137
GO:0031929	Process	TOR signaling	IEA
GO:0031931	Component	TORC1 complex	IBA
GO:0031931	Component	TORC1 complex	IDA	12150926, 12718876, 15467718, 24036451, 24403073, 25940091, 26678875, 27909983, 29236692, 31601764
GO:0031931	Component	TORC1 complex	IEA
GO:0031931	Component	TORC1 complex	IPI	26678875
GO:0032008	Process	Positive regulation of TOR signaling	IDA	12150926, 18439900
GO:0035176	Process	Social behavior	ISS
GO:0038202	Process	TORC1 signaling	IBA
GO:0038202	Process	TORC1 signaling	IDA	12087098, 29750193
GO:0038202	Process	TORC1 signaling	IDA	12150926, 12747827, 24403073, 26588989, 30197302, 31112131, 32561715, 35927303
GO:0038202	Process	TORC1 signaling	IEA
GO:0038202	Process	TORC1 signaling	IMP	12718876
GO:0043025	Component	Neuronal cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	19211835
GO:0045672	Process	Positive regulation of osteoclast differentiation	ISS
GO:0045821	Process	Positive regulation of glycolytic process	NAS	20670887
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IMP	20233713
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0046889	Process	Positive regulation of lipid biosynthetic process	NAS	20670887
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0065008	Process	Regulation of biological quality	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IBA
GO:0071230	Process	Cellular response to amino acid stimulus	IMP	20381137
GO:0071233	Process	Cellular response to L-leucine	IDA	22424946
GO:0071333	Process	Cellular response to glucose stimulus	IDA	37541260
GO:0071456	Process	Cellular response to hypoxia	NAS	17041623
GO:0071470	Process	Cellular response to osmotic stress	NAS	17041623
GO:0071889	Function	14-3-3 protein binding	IDA	18439900
GO:0140767	Function	Enzyme-substrate adaptor activity	IDA	12150926, 12747827, 24403073
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	18426977
GO:1901331	Process	Positive regulation of odontoblast differentiation	ISS
GO:1902554	Component	Serine/threonine protein kinase complex	IDA	26678875
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692, 31601708
GO:1905857	Process	Positive regulation of pentose-phosphate shunt	NAS	20670887

Other IDs

• MIM: 607130
• HGNC: 30287
• e!Ensembl: ENSG00000141564

Protein

• UniProt ID: Q8N122
• Protein name: Regulatory-associated protein of mTOR (Raptor) (p150 target of rapamycin (TOR)-scaffold protein)
• Protein function: Component of the mechanistic target of rapamycin complex 1 (mTORC1), an evolutionarily conserved central nutrient sensor that stimulates anabolic reactions and macromolecule biosynthesis to promote cellular biomass generation and growth (PubMed:
• PDB: 5H64, 6BCU, 6BCX, 6SB0, 6SB2, 6U62, 7OWG, 7PEA, 7PEB, 7PEC, 7UX2, 7UXC, 7UXH, 8ERA, 8RCH, 8RCK, 8RCN, 9F42, 9F43, 9F44, 9F45
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14538	Raptor_N	55 → 206	Raptor N-terminal CASPase like domain	Domain
  PF02985	HEAT	602 → 630	HEAT repeat	Repeat
  PF00400	WD40	1156 → 1194	WD domain, G-beta repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in skeletal muscle, and in a lesser extent in brain, lung, small intestine, kidney and placenta. {ECO:0000269|PubMed:12150925, ECO:0000269|PubMed:12408816}.; TISSUE SPECIFICITY: [Isoform 3]: Widely expressed, with high
• Sequence:

  MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
  ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
  QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
  DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
  IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
  RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
  NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
  TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
  QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
  VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
  HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
  KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
  SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
  FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
  ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
  LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
  DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
  RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
  CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
  SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
  ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
  IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
  NDYYISVYSVEKRVR

• Sequence length: 1335

Pathways

KEGG:

Autophagy - other
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Thermogenesis
Insulin signaling pathway
Shigellosis
MicroRNAs in cancer

Reactome:

Macroautophagy
mTOR signalling
mTORC1-mediated signalling
HSF1-dependent transactivation
Energy dependent regulation of mTOR by LKB1-AMPK
TP53 Regulates Metabolic Genes
Regulation of PTEN gene transcription
Amino acids regulate mTORC1