Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57521
Gene name Gene Name - the full gene name approved by the HGNC.	Regulatory associated protein of MTOR complex 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RPTOR
Synonyms (NCBI Gene) Gene synonyms aliases	KOG1, Mip1
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-b

Show/Hide all(90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050023	hsa-miR-27a-3p	CLASH	23622248
MIRT046186	hsa-miR-27b-3p	CLASH	23622248
MIRT1319074	hsa-miR-1225-3p	CLIP-seq
MIRT1319075	hsa-miR-125a-5p	CLIP-seq
MIRT1319076	hsa-miR-125b	CLIP-seq
MIRT1319077	hsa-miR-129-3p	CLIP-seq
MIRT1319078	hsa-miR-1908	CLIP-seq
MIRT1319079	hsa-miR-2278	CLIP-seq
MIRT1319080	hsa-miR-23a	CLIP-seq
MIRT1319081	hsa-miR-23b	CLIP-seq
MIRT1319082	hsa-miR-23c	CLIP-seq
MIRT1319083	hsa-miR-2861	CLIP-seq
MIRT1319084	hsa-miR-3064-5p	CLIP-seq
MIRT1319085	hsa-miR-3127-3p	CLIP-seq
MIRT1319086	hsa-miR-3144-5p	CLIP-seq
MIRT1319087	hsa-miR-3151	CLIP-seq
MIRT1319088	hsa-miR-3153	CLIP-seq
MIRT1319089	hsa-miR-3180	CLIP-seq
MIRT1319090	hsa-miR-3180-3p	CLIP-seq
MIRT1319091	hsa-miR-3180-5p	CLIP-seq
MIRT1319092	hsa-miR-3186-3p	CLIP-seq
MIRT1319093	hsa-miR-3191	CLIP-seq
MIRT1319094	hsa-miR-3196	CLIP-seq
MIRT1319095	hsa-miR-323-3p	CLIP-seq
MIRT1319096	hsa-miR-3652	CLIP-seq
MIRT1319097	hsa-miR-3937	CLIP-seq
MIRT1319098	hsa-miR-4270	CLIP-seq
MIRT1319099	hsa-miR-4319	CLIP-seq
MIRT1319100	hsa-miR-4417	CLIP-seq
MIRT1319101	hsa-miR-4430	CLIP-seq
MIRT1319102	hsa-miR-4437	CLIP-seq
MIRT1319103	hsa-miR-4441	CLIP-seq
MIRT1319104	hsa-miR-4447	CLIP-seq
MIRT1319105	hsa-miR-4472	CLIP-seq
MIRT1319106	hsa-miR-4488	CLIP-seq
MIRT1319107	hsa-miR-4505	CLIP-seq
MIRT1319108	hsa-miR-4641	CLIP-seq
MIRT1319109	hsa-miR-4651	CLIP-seq
MIRT1319110	hsa-miR-4652-5p	CLIP-seq
MIRT1319111	hsa-miR-4674	CLIP-seq
MIRT1319112	hsa-miR-4685-5p	CLIP-seq
MIRT1319113	hsa-miR-4690-3p	CLIP-seq
MIRT1319114	hsa-miR-4697-5p	CLIP-seq
MIRT1319115	hsa-miR-4731-5p	CLIP-seq
MIRT1319116	hsa-miR-4732-3p	CLIP-seq
MIRT1319117	hsa-miR-4746-3p	CLIP-seq
MIRT1319118	hsa-miR-4747-5p	CLIP-seq
MIRT1319119	hsa-miR-4781-5p	CLIP-seq
MIRT1319120	hsa-miR-4786-3p	CLIP-seq
MIRT1319121	hsa-miR-4786-5p	CLIP-seq
MIRT1319122	hsa-miR-486-3p	CLIP-seq
MIRT1319123	hsa-miR-491-5p	CLIP-seq
MIRT1319124	hsa-miR-520a-5p	CLIP-seq
MIRT1319125	hsa-miR-525-5p	CLIP-seq
MIRT1319126	hsa-miR-541	CLIP-seq
MIRT1319127	hsa-miR-608	CLIP-seq
MIRT1319128	hsa-miR-654-5p	CLIP-seq
MIRT1319129	hsa-miR-662	CLIP-seq
MIRT1319130	hsa-miR-663	CLIP-seq
MIRT1319131	hsa-miR-670	CLIP-seq
MIRT1319132	hsa-miR-671-5p	CLIP-seq
MIRT1319133	hsa-miR-885-3p	CLIP-seq
MIRT1553187	hsa-miR-149	CLIP-seq
MIRT1319120	hsa-miR-4786-3p	CLIP-seq
MIRT1319075	hsa-miR-125a-5p	CLIP-seq
MIRT1319076	hsa-miR-125b	CLIP-seq
MIRT1319080	hsa-miR-23a	CLIP-seq
MIRT1319081	hsa-miR-23b	CLIP-seq
MIRT1319082	hsa-miR-23c	CLIP-seq
MIRT1319083	hsa-miR-2861	CLIP-seq
MIRT1319084	hsa-miR-3064-5p	CLIP-seq
MIRT2094861	hsa-miR-3194-5p	CLIP-seq
MIRT1319096	hsa-miR-3652	CLIP-seq
MIRT1319099	hsa-miR-4319	CLIP-seq
MIRT2094862	hsa-miR-4323	CLIP-seq
MIRT1319101	hsa-miR-4430	CLIP-seq
MIRT2094863	hsa-miR-4449	CLIP-seq
MIRT1319107	hsa-miR-4505	CLIP-seq
MIRT2094864	hsa-miR-452	CLIP-seq
MIRT2094865	hsa-miR-4639-3p	CLIP-seq
MIRT2094866	hsa-miR-4676-3p	CLIP-seq
MIRT2094867	hsa-miR-4693-5p	CLIP-seq
MIRT1319126	hsa-miR-541	CLIP-seq
MIRT2094868	hsa-miR-619	CLIP-seq
MIRT1319128	hsa-miR-654-5p	CLIP-seq
MIRT2094869	hsa-miR-668	CLIP-seq
MIRT1319080	hsa-miR-23a	CLIP-seq
MIRT1319081	hsa-miR-23b	CLIP-seq
MIRT1319082	hsa-miR-23c	CLIP-seq
MIRT2458615	hsa-miR-1912	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
POU2F1	Unknown	21060808
RARA	Unknown	21060808

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001002	Function	RNA polymerase III type 1 promoter sequence-specific DNA binding	IDA	20233713
GO:0001003	Function	RNA polymerase III type 2 promoter sequence-specific DNA binding	IDA	20233713
GO:0001006	Function	RNA polymerase III type 3 promoter sequence-specific DNA binding	IDA	20233713
GO:0001156	Function	TFIIIC-class transcription factor complex binding	IDA	20543138
GO:0001558	Process	Regulation of cell growth	IMP	20381137
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0005515	Function	Protein binding	IPI	12150925, 12150926, 12408816, 17386266, 17461779, 17565979, 18337751, 18955708, 19446321, 19619545, 19875983, 20347422, 20543138, 20562859, 21045808, 21339740, 21471201, 21614075, 22424946, 23027611, 23263282, 23953116, 24036451, 24375676, 25446900, 25561175, 25567906, 25657994, 256
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	20381137
GO:0005764	Component	Lysosome	IDA	20381137
GO:0005764	Component	Lysosome	IMP	22424946
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007050	Process	Cell cycle arrest	TAS
GO:0008361	Process	Regulation of cell size	IMP	12150925
GO:0009267	Process	Cellular response to starvation	IBA	21873635
GO:0010494	Component	Cytoplasmic stress granule	IDA	25940091
GO:0010506	Process	Regulation of autophagy	IBA	21873635
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	18426977
GO:0016032	Process	Viral process	IEA
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0019901	Function	Protein kinase binding	IPI	18439900
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	12718876
GO:0030295	Function	Protein kinase activator activity	IDA	12150926
GO:0030307	Process	Positive regulation of cell growth	IBA	21873635
GO:0030307	Process	Positive regulation of cell growth	IMP	18426977
GO:0030425	Component	Dendrite	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA	21873635
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	12150926
GO:0031669	Process	Cellular response to nutrient levels	IMP	12150925
GO:0031929	Process	TOR signaling	IBA	21873635
GO:0031929	Process	TOR signaling	IDA	20381137
GO:0031931	Component	TORC1 complex	IBA	21873635
GO:0031931	Component	TORC1 complex	IDA	12150926, 12718876, 15467718, 24036451, 25940091
GO:0032008	Process	Positive regulation of TOR signaling	IDA	12150926, 18439900
GO:0032147	Process	Activation of protein kinase activity	IEA
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	18426977
GO:0038202	Process	TORC1 signaling	IBA	21873635
GO:0038202	Process	TORC1 signaling	IMP	12718876
GO:0043025	Component	Neuronal cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	19211835
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IMP	20233713
GO:0071230	Process	Cellular response to amino acid stimulus	IBA	21873635
GO:0071230	Process	Cellular response to amino acid stimulus	IMP	20381137
GO:0071233	Process	Cellular response to leucine	IDA	22424946
GO:0071889	Function	14-3-3 protein binding	IDA	18439900
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	IEA
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IBA	21873635
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	12150926
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	18426977

MIM	HGNC	e!Ensembl
607130	30287	ENSG00000141564

Protein

UniProt ID

Q8N122

Protein name

Regulatory-associated protein of mTOR (Raptor) (p150 target of rapamycin (TOR)-scaffold protein)

Protein function

Component of the mechanistic target of rapamycin complex 1 (mTORC1), an evolutionarily conserved central nutrient sensor that stimulates anabolic reactions and macromolecule biosynthesis to promote cellular biomass generation and growth (PubMed:

PDB

5H64 , 6BCU , 6BCX , 6SB0 , 6SB2 , 6U62 , 7OWG , 7PEA , 7PEB , 7PEC , 7UX2 , 7UXC , 7UXH , 8ERA , 8RCH , 8RCK , 8RCN , 9F42 , 9F43 , 9F44 , 9F45

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14538	Raptor_N	55 → 206	Raptor N-terminal CASPase like domain	Domain
PF02985	HEAT	602 → 630	HEAT repeat	Repeat
PF00400	WD40	1156 → 1194	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle, and in a lesser extent in brain, lung, small intestine, kidney and placenta. {ECO:0000269|PubMed:12150925, ECO:0000269|PubMed:12408816}.; TISSUE SPECIFICITY: [Isoform 3]: Widely expressed, with high

Sequence

MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR

Sequence length

1335

Interactions

View interactions

	KEGG		Reactome
	Autophagy - other Autophagy - animal mTOR signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Longevity regulating pathway Longevity regulating pathway - multiple species Thermogenesis Insulin signaling pathway Shigellosis MicroRNAs in cancer		Macroautophagy mTOR signalling mTORC1-mediated signalling HSF1-dependent transactivation Energy dependent regulation of mTOR by LKB1-AMPK TP53 Regulates Metabolic Genes Regulation of PTEN gene transcription Amino acids regulate mTORC1

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Hypertension	Hypertensive disease	rs13306026	30487518
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Moyamoya disease	Moyamoya Disease, Moyamoya disease 1	rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410	29273593
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	23563607

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Source
Unknown
Schizophrenia	Schizophrenia	GWAS
Moyamoya Disease	Moyamoya Disease	GWAS
Bipolar Disorder	Bipolar Disorder	GWAS
Gout	Gout	GWAS
Diabetes	Diabetes	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS
Oligodendroglioma	Oligodendroglioma	GWAS
Renal Carcinoma	Renal Carcinoma	GWAS

Show/Hide Text Mining Associations (47)

Disease Name	Relationship Type	References
Associations from Text Mining
beta Thalassemia	Associate	25849663
Breast Neoplasms	Associate	27305912, 27314662, 27577081, 29128895
Breast Neoplasms	Inhibit	27314662
Carcinogenesis	Associate	27314662
Carcinoma Hepatocellular	Associate	24312415
Carcinoma Renal Cell	Associate	35927303
Colonic Neoplasms	Associate	29882195
Colorectal Neoplasms	Associate	21430067, 32000660, 34311674
Cystic Fibrosis	Associate	27284727
Death	Associate	20530239
Diabetes Mellitus Type 2	Associate	25867326, 37356726
Diabetic Nephropathies	Associate	25867326
Diabetic Nephropathies	Inhibit	31281543
Drug Related Side Effects and Adverse Reactions	Associate	33027666
Esophageal Squamous Cell Carcinoma	Associate	23524405
Fibrosis	Inhibit	27284727
Gestational Weight Gain	Associate	37513594
Glioma	Associate	26361958
Gout	Associate	32630231
Guillain Barre Syndrome	Inhibit	36139470
Hyperglycemia	Associate	28727815
Hypertension	Associate	38497230
Infections	Associate	36450776
Inflammation	Associate	32630231
Inflammatory Bowel Diseases	Associate	36029471
Intervertebral Disc Degeneration	Associate	39682777
Kidney Neoplasms	Associate	29389967
Macular Degeneration	Associate	34948253
Melanoma	Associate	18679422
Myocardial Infarction	Associate	33836805
Neoplasm Metastasis	Stimulate	21430067
Neoplasms	Associate	29128895, 35927303, 37202753
Neurofibromatosis 1	Associate	29973652
Non Muscle Invasive Bladder Neoplasms	Associate	20530239
Obesity	Associate	23563607, 33315090, 37513594
Ovarian Neoplasms	Associate	27211906, 37304865
Overweight	Associate	25249372
Pancreatic Neoplasms	Associate	30997723
Pleural Diseases	Associate	32365959
Pneumonia	Associate	28727815
Prostatic Neoplasms	Associate	23272152, 23646189, 31995655
Psoriasis	Associate	16374479
Sjogren's Syndrome	Associate	35896530
Squamous Cell Carcinoma of Head and Neck	Stimulate	33482765
Tuberculosis	Associate	32365959
Tuberculosis Pulmonary	Associate	37493735
Urinary Bladder Neoplasms	Associate	19875696

RPTOR (regulatory associated protein of MTOR complex 1)