Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5734
Gene name Gene Name - the full gene name approved by the HGNC.	Prostaglandin E receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTGER4
Synonyms (NCBI Gene) Gene synonyms aliases	EP4, EP4R
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 indu

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053339	hsa-miR-101-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot, Motility assay, CAM assay, Colony formation assay	22353936
MIRT053339	hsa-miR-101-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot, Motility assay, CAM assay, Colony formation assay	22353936
MIRT439876	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439875	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439876	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726839	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726840	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726838	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726837	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439875	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT215682	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT215685	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT215681	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1272668	hsa-miR-2054	CLIP-seq
MIRT1272669	hsa-miR-34c-3p	CLIP-seq
MIRT1272670	hsa-miR-380	CLIP-seq
MIRT1272671	hsa-miR-4428	CLIP-seq
MIRT1272672	hsa-miR-4775	CLIP-seq
MIRT1272673	hsa-miR-590-3p	CLIP-seq
MIRT1272674	hsa-miR-889	CLIP-seq
MIRT2306449	hsa-miR-1237	CLIP-seq
MIRT2306450	hsa-miR-1263	CLIP-seq
MIRT2306451	hsa-miR-3120-3p	CLIP-seq
MIRT2306452	hsa-miR-3177-5p	CLIP-seq
MIRT2306453	hsa-miR-3192	CLIP-seq
MIRT2306454	hsa-miR-3614-5p	CLIP-seq
MIRT2306455	hsa-miR-3663-3p	CLIP-seq
MIRT2306456	hsa-miR-4303	CLIP-seq
MIRT2306457	hsa-miR-4501	CLIP-seq
MIRT2306458	hsa-miR-4504	CLIP-seq
MIRT2306459	hsa-miR-542-3p	CLIP-seq
MIRT2457400	hsa-miR-188-5p	CLIP-seq
MIRT2457401	hsa-miR-204	CLIP-seq
MIRT2457402	hsa-miR-211	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
NFKB1	Unknown	23300802
RELA	Unknown	23300802
XBP1	Unknown	23300802

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	1833717
GO:0001818	Process	Negative regulation of cytokine production	ISS
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004955	Function	Prostaglandin receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	IBA
GO:0004957	Function	Prostaglandin E receptor activity	IDA	8078484, 8163486
GO:0004957	Function	Prostaglandin E receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	16424369
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8163486, 16424369
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEP	8862514
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IDA	8163486
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	8078484, 16204467
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	16204467
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	16204467
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007254	Process	JNK cascade	ISS
GO:0009612	Process	Response to mechanical stimulus	IEP	21723865
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	8163486
GO:0033624	Process	Negative regulation of integrin activation	IDA	21681739
GO:0033993	Process	Response to lipid	IEA
GO:0034695	Process	Response to prostaglandin E	IDA	16204467, 17110384
GO:0034695	Process	Response to prostaglandin E	IDA	8163486
GO:0042093	Process	T-helper cell differentiation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050728	Process	Negative regulation of inflammatory response	IDA	16424369
GO:0050729	Process	Positive regulation of inflammatory response	IDA	16424369
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0051492	Process	Regulation of stress fiber assembly	ISS
GO:0060348	Process	Bone development	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	ISS
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IBA
GO:2000420	Process	Negative regulation of eosinophil extravasation	IDA	21681739

MIM	HGNC	e!Ensembl
601586	9596	ENSG00000171522

Protein

UniProt ID

P35408

Protein name

Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)

Protein function

Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal ep

PDB

5YHL , 5YWY , 7D7M , 8GCM , 8GCP , 8GD9 , 8GDA , 8GDB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	34 → 329	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.

Sequence

MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI

Sequence length

488

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Efferocytosis Inflammatory mediator regulation of TRP channels Renin secretion Human cytomegalovirus infection Human papillomavirus infection Pathways in cancer		Prostanoid ligand receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

PTGER4 (prostaglandin E receptor 4)