Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5734
Gene name Gene Name - the full gene name approved by the HGNC.	Prostaglandin E receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTGER4
Synonyms (NCBI Gene) Gene synonyms aliases	EP4, EP4R
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 indu

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053339	hsa-miR-101-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot, Motility assay, CAM assay, Colony formation assay	22353936
MIRT053339	hsa-miR-101-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot, Motility assay, CAM assay, Colony formation assay	22353936
MIRT439876	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439875	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439876	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726839	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726840	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726838	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726837	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439875	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT215682	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT215685	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT215681	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1272668	hsa-miR-2054	CLIP-seq
MIRT1272669	hsa-miR-34c-3p	CLIP-seq
MIRT1272670	hsa-miR-380	CLIP-seq
MIRT1272671	hsa-miR-4428	CLIP-seq
MIRT1272672	hsa-miR-4775	CLIP-seq
MIRT1272673	hsa-miR-590-3p	CLIP-seq
MIRT1272674	hsa-miR-889	CLIP-seq
MIRT2306449	hsa-miR-1237	CLIP-seq
MIRT2306450	hsa-miR-1263	CLIP-seq
MIRT2306451	hsa-miR-3120-3p	CLIP-seq
MIRT2306452	hsa-miR-3177-5p	CLIP-seq
MIRT2306453	hsa-miR-3192	CLIP-seq
MIRT2306454	hsa-miR-3614-5p	CLIP-seq
MIRT2306455	hsa-miR-3663-3p	CLIP-seq
MIRT2306456	hsa-miR-4303	CLIP-seq
MIRT2306457	hsa-miR-4501	CLIP-seq
MIRT2306458	hsa-miR-4504	CLIP-seq
MIRT2306459	hsa-miR-542-3p	CLIP-seq
MIRT2457400	hsa-miR-188-5p	CLIP-seq
MIRT2457401	hsa-miR-204	CLIP-seq
MIRT2457402	hsa-miR-211	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
NFKB1	Unknown	23300802
RELA	Unknown	23300802
XBP1	Unknown	23300802

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	ISS
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0004957	Function	Prostaglandin E receptor activity	IBA	21873635
GO:0004957	Function	Prostaglandin E receptor activity	IDA	8163486
GO:0005515	Function	Protein binding	IPI	16424369
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	IEP	8862514
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IDA	8163486
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007254	Process	JNK cascade	ISS
GO:0009612	Process	Response to mechanical stimulus	IEP	21723865
GO:0016021	Component	Integral component of membrane	NAS	8163486
GO:0030278	Process	Regulation of ossification	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033624	Process	Negative regulation of integrin activation	IDA	21681739
GO:0042093	Process	T-helper cell differentiation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IBA	21873635
GO:0050728	Process	Negative regulation of inflammatory response	IDA	16424369
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0051492	Process	Regulation of stress fiber assembly	ISS
GO:0060348	Process	Bone development	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	ISS
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IBA	21873635
GO:2000420	Process	Negative regulation of eosinophil extravasation	IDA	21681739

MIM	HGNC	e!Ensembl
601586	9596	ENSG00000171522

Protein

UniProt ID

P35408

Protein name

Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)

Protein function

Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal ep

PDB

5YHL , 5YWY , 7D7M , 8GCM , 8GCP , 8GD9 , 8GDA , 8GDB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	34 → 329	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.

Sequence

MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI

Sequence length

488

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Efferocytosis Inflammatory mediator regulation of TRP channels Renin secretion Human cytomegalovirus infection Human papillomavirus infection Pathways in cancer		Prostanoid ligand receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044	19075289

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Endometriosis	Endometriosis		19407222	ClinVar

Show/Hide Text Mining Associations (72)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	34774558
Adenocarcinoma	Associate	12468638
Adenocarcinoma	Inhibit	37670284
Adenocarcinoma of Lung	Associate	11997037
Aortic Aneurysm Abdominal	Associate	24133193, 24876670
Arthritis Psoriatic	Stimulate	31253169
Arthritis Rheumatoid	Associate	26538147
Attention Deficit Disorder with Hyperactivity	Associate	24571439
Autistic Disorder	Associate	24571439
Breast Neoplasms	Associate	18319253, 20503412, 27869171
Carcinogenesis	Associate	21589857
Carcinogenesis	Stimulate	22353936, 26511970
Carcinoma Hepatocellular	Associate	34028567
Carcinoma Non Small Cell Lung	Associate	16061473, 17237224, 26689593
Cholangiocarcinoma	Associate	24839005
Colitis Lymphocytic	Associate	23613969
Colitis Ulcerative	Associate	21818367, 28885228
Colorectal Neoplasms	Associate	19558693, 28587064, 36142151
Crohn Disease	Associate	17447842, 20117335, 21548950, 23300802, 28885228, 33600772
Drug Related Side Effects and Adverse Reactions	Associate	30894570
Ductus Arteriosus Patent	Associate	12598419, 27465141
Endometrial Neoplasms	Associate	21589857, 27230680
Endometriosis	Associate	23242524, 24064359, 26240828, 33543288
Eosinophilic Esophagitis	Inhibit	30989466
Erythema Nodosum	Associate	24487271
Fibrosis	Associate	34774558
Gamophobia	Inhibit	34502044
Glioblastoma	Associate	18346464, 19934343, 33941107, 37232020
Heart Defects Congenital	Associate	12598419
Hypertension Pulmonary	Inhibit	31476020
Hypoxia	Stimulate	21589857
Infertility	Associate	24064359
Inflammation	Associate	12566441, 22531917, 26926362
Inflammation	Inhibit	25670004, 34774558
Inflammatory Bowel Diseases	Associate	23613969, 24487271, 36155972
Inflammatory Breast Neoplasms	Associate	20503412
Joint Diseases	Associate	26538147
Kidney Neoplasms	Associate	21832044, 22580611
Laryngeal Neoplasms	Associate	31969157
Lead Poisoning Nervous System	Associate	26538147
Leukemia	Associate	8910368
Lung Diseases	Associate	34408226
Lung Neoplasms	Associate	17237224, 20353998, 26689593, 27794413, 33167712, 34408226
Mouth Diseases	Associate	20388794, 25843056
Multiple Pulmonary Nodules	Associate	33691657
Multiple Sclerosis	Inhibit	25670004
Multiple Sclerosis	Associate	40299057
Neoplasms	Associate	12566441, 20100359, 21972293, 26511970, 26689593, 27127881, 35549670, 36436093
Neoplasms	Stimulate	17201907, 21589857
Neoplasms	Inhibit	36142151
Neuroblastoma	Associate	22276108
Osteoarthritis	Associate	18802112
Ovarian Diseases	Associate	33543288
Ovarian Neoplasms	Associate	15347673, 22025564
Pain	Associate	24064359
Pancreatic Neoplasms	Associate	26310818, 37457723
Papilloma	Associate	36608264
Peritoneal Diseases	Associate	33543288
Peritoneal Neoplasms	Associate	17201907
Plaque Atherosclerotic	Associate	12215436
Primary Graft Dysfunction	Associate	24467603
Prostatic Neoplasms	Stimulate	23364535
Pulmonary Arterial Hypertension	Associate	36690956
Pulmonary Disease Chronic Obstructive	Stimulate	26926362
Pyoderma Gangrenosum	Associate	24487271
Solitary Pulmonary Nodule	Associate	33167712
Spondylitis Ankylosing	Associate	24069348
Spondylitis Ankylosing	Stimulate	31253169
Stomach Neoplasms	Associate	27127881, 30191681, 37670284
Thyroid Cancer Papillary	Stimulate	26511970
Thyroid Carcinoma Anaplastic	Associate	30140269
Uterine Diseases	Associate	26240828

PTGER4 (prostaglandin E receptor 4)