Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5732
Gene name Gene Name - the full gene name approved by the HGNC.	Prostaglandin E receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTGER2
Synonyms (NCBI Gene) Gene synonyms aliases	COX-2, EP2
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSe

Show/Hide all(50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019383	hsa-miR-148b-3p	Microarray	17612493
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT1272599	hsa-miR-1276	CLIP-seq
MIRT1272600	hsa-miR-128	CLIP-seq
MIRT1272601	hsa-miR-130a	CLIP-seq
MIRT1272602	hsa-miR-130b	CLIP-seq
MIRT1272603	hsa-miR-148a	CLIP-seq
MIRT1272604	hsa-miR-148b	CLIP-seq
MIRT1272605	hsa-miR-152	CLIP-seq
MIRT1272606	hsa-miR-188-3p	CLIP-seq
MIRT1272607	hsa-miR-19a	CLIP-seq
MIRT1272608	hsa-miR-19b	CLIP-seq
MIRT1272609	hsa-miR-27a	CLIP-seq
MIRT1272610	hsa-miR-27b	CLIP-seq
MIRT1272611	hsa-miR-301a	CLIP-seq
MIRT1272612	hsa-miR-301b	CLIP-seq
MIRT1272613	hsa-miR-3666	CLIP-seq
MIRT1272614	hsa-miR-421	CLIP-seq
MIRT1272615	hsa-miR-4272	CLIP-seq
MIRT1272616	hsa-miR-4295	CLIP-seq
MIRT1272617	hsa-miR-4311	CLIP-seq
MIRT1272618	hsa-miR-454	CLIP-seq
MIRT1272619	hsa-miR-4709-5p	CLIP-seq
MIRT1272620	hsa-miR-4731-3p	CLIP-seq
MIRT1272621	hsa-miR-4801	CLIP-seq
MIRT1272622	hsa-miR-496	CLIP-seq
MIRT1272623	hsa-miR-499-3p	CLIP-seq
MIRT1272624	hsa-miR-499a-3p	CLIP-seq
MIRT1272625	hsa-miR-532-3p	CLIP-seq
MIRT1272626	hsa-miR-580	CLIP-seq
MIRT1272627	hsa-miR-583	CLIP-seq
MIRT1272628	hsa-miR-616	CLIP-seq
MIRT2080156	hsa-miR-4328	CLIP-seq
MIRT2080157	hsa-miR-4420	CLIP-seq
MIRT2080158	hsa-miR-4503	CLIP-seq
MIRT2306422	hsa-miR-2115	CLIP-seq
MIRT2306423	hsa-miR-214	CLIP-seq
MIRT2306424	hsa-miR-3619-5p	CLIP-seq
MIRT2306425	hsa-miR-3692	CLIP-seq
MIRT2306426	hsa-miR-3977	CLIP-seq
MIRT1272614	hsa-miR-421	CLIP-seq
MIRT1272615	hsa-miR-4272	CLIP-seq
MIRT2306427	hsa-miR-4690-5p	CLIP-seq
MIRT1272619	hsa-miR-4709-5p	CLIP-seq
MIRT2306428	hsa-miR-516a-3p	CLIP-seq
MIRT1272628	hsa-miR-616	CLIP-seq
MIRT2306429	hsa-miR-761	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SETBP1	Repression	18419541

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004957	Function	Prostaglandin E receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	10462542
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IBA	21873635
GO:0071380	Process	Cellular response to prostaglandin E stimulus	ISS
GO:1904346	Process	Positive regulation of gastric mucosal blood circulation	IEA

MIM	HGNC	e!Ensembl
176804	9594	ENSG00000125384

Protein

UniProt ID

P43116

Protein name

Prostaglandin E2 receptor EP2 subtype (PGE receptor EP2 subtype) (PGE2 receptor EP2 subtype) (Prostanoid EP2 receptor)

Protein function

Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscl

PDB

7CX2 , 7CX3 , 7CX4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	56 → 315	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Placenta and lung.

Sequence

MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

Sequence length

358

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Efferocytosis Inflammatory mediator regulation of TRP channels Renin secretion Human cytomegalovirus infection Pathways in cancer		Prostanoid ligand receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Evidence	References	Source
Unknown
Asthma	Asthma, Asthma, Aspirin-Induced		16502481	ClinVar
Endometriosis	Endometriosis		19407222	ClinVar
Alzheimer disease	Alzheimer disease			GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA

Show/Hide Text Mining Associations (63)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute On Chronic Liver Failure	Associate	30890164
Adenocarcinoma	Associate	18666211
Adenocarcinoma Mucinous	Stimulate	20200425
Adenoma	Associate	22551900
Aortic Aneurysm Abdominal	Associate	24133193
Arthritis Rheumatoid	Associate	14558087
Asthma	Associate	22432035
Asthma Aspirin Induced	Inhibit	20587336
Atherosclerosis	Associate	14752026
Breast Neoplasms	Associate	18319253
Bronchiolitis Obliterans Syndrome	Associate	21940790
Calcinosis	Stimulate	34862858
Carcinoma Non Small Cell Lung	Associate	18666211
Carcinoma Pancreatic Ductal	Associate	28222855
Cerebral Infarction	Associate	16879213
Colorectal Neoplasms	Associate	17555711, 20200425, 24908683, 37090726
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	16879213
Cystitis Interstitial	Associate	25595860
Disease Progression	Associate	26051534, 30961940
Endometriosis	Associate	23242524, 33543288
Eosinophilic Esophagitis	Inhibit	30989466
Esophageal Squamous Cell Carcinoma	Associate	29272001
Farber Lipogranulomatosis	Associate	17107625
Glioblastoma	Associate	33919029, 37232020
Graves Ophthalmopathy	Associate	34831419
Hypotension	Inhibit	27321910
Idiopathic Noncirrhotic Portal Hypertension	Associate	26549939
Infertility	Associate	24064359
Inflammation	Associate	14558087, 22531917, 23968978, 26926362, 30040868, 30562046, 30890164, 30961940
Kidney Neoplasms	Associate	22580611
Leukemia	Associate	8910368
Mouth Diseases	Associate	20388794, 25843056, 32851536
Mouth Diseases	Stimulate	25595860
Multiple Sclerosis	Associate	40299057
Neoplasm Metastasis	Stimulate	23364535
Neoplasm Metastasis	Associate	37796697
Neoplasms	Stimulate	11344234, 20200425, 37796697
Neoplasms	Associate	18666211, 21972293, 25828575, 26965582, 35549670, 36436093
Neuroblastoma	Associate	22276108
Neuroendocrine Tumors	Associate	26965582
Ocular Hypertension	Associate	27321910
Osteoarthritis	Associate	19180509
Osteoarthritis Knee	Associate	27751171
Ovarian Diseases	Associate	33543288
Ovarian Neoplasms	Associate	15347673, 22025564, 37796697
Pain	Associate	24064359
Pancreatic Neoplasms	Associate	37457723
Papilloma	Associate	36608264
Peritoneal Diseases	Associate	33543288
Polycystic Kidney Autosomal Dominant	Associate	34886911
Polyps	Associate	30040868
Prostatic Neoplasms	Stimulate	23364535, 27012192
Prostatic Neoplasms	Associate	25828575
Pulmonary Disease Chronic Obstructive	Stimulate	26926362
Pulmonary Fibrosis	Associate	30485339
Rectal Neoplasms	Associate	24908683
Respiratory Tract Diseases	Associate	30961940
Squamous Cell Carcinoma of Head and Neck	Associate	31969157
Stomach Neoplasms	Associate	30510283
Thyroid Cancer Papillary	Associate	26511970
Ureteral Neoplasms	Stimulate	34862858
Uterine Cervical Dysplasia	Associate	32851536
Uterine Cervical Neoplasms	Associate	11344234, 31980713

PTGER2 (prostaglandin E receptor 2)