Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5731
Gene name Gene Name - the full gene name approved by the HGNC.	Prostaglandin E receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTGER1
Synonyms (NCBI Gene) Gene synonyms aliases	EP1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the G protein-coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). Through a phosphatidylinositol-calcium second messenger system, G-Q proteins mediate this

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT2080144	hsa-miR-1587	CLIP-seq
MIRT2080145	hsa-miR-1915	CLIP-seq
MIRT2080146	hsa-miR-4417	CLIP-seq
MIRT2080147	hsa-miR-4492	CLIP-seq
MIRT2080148	hsa-miR-4498	CLIP-seq
MIRT2080149	hsa-miR-4656	CLIP-seq
MIRT2080150	hsa-miR-4675	CLIP-seq
MIRT2080151	hsa-miR-4690-3p	CLIP-seq
MIRT2080152	hsa-miR-4741	CLIP-seq
MIRT2080153	hsa-miR-541	CLIP-seq
MIRT2080154	hsa-miR-654-5p	CLIP-seq
MIRT2080155	hsa-miR-762	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004955	Function	Prostaglandin receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	IBA
GO:0004957	Function	Prostaglandin E receptor activity	IDA	8253813
GO:0004957	Function	Prostaglandin E receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	TAS	8253813
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8253813
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8253813
GO:0006954	Process	Inflammatory response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8253813
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8253813
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007206	Process	Phospholipase C-activating G protein-coupled glutamate receptor signaling pathway	IDA	8253813
GO:0016020	Component	Membrane	IEA
GO:0031748	Function	D1 dopamine receptor binding	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034695	Process	Response to prostaglandin E	IDA	8253813
GO:0034695	Process	Response to prostaglandin E	IDA	8253813

MIM	HGNC	e!Ensembl
176802	9593	ENSG00000160951

Protein

UniProt ID

P34995

Protein name

Prostaglandin E2 receptor EP1 subtype (PGE receptor EP1 subtype) (PGE2 receptor EP1 subtype) (Prostanoid EP1 receptor)

Protein function

Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the s

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	49 → 351	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Abundant in kidney. Lower level expression in lung, skeletal muscle and spleen, lowest expression in testis and not detected in liver brain and heart.

Sequence

MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF

Sequence length

402

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Human cytomegalovirus infection Pathways in cancer		Prostanoid ligand receptors G alpha (q) signalling events

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Urolithiasis	Urolithiasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (33)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Asthma Aspirin Induced	Inhibit	20587336
Breast Neoplasms	Associate	16570043, 17906615
Bronchiolitis Obliterans Syndrome	Associate	21940790
Carcinogenesis	Associate	36436093
Carcinoma Hepatocellular	Associate	15294900, 22555372
Cholangiocarcinoma	Associate	24839005
Chondrosarcoma	Associate	20178602
Colorectal Neoplasms	Inhibit	17906615
Cystitis Interstitial	Associate	25595860
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	20648052
Endometrial Neoplasms	Inhibit	21589857
Farber Lipogranulomatosis	Associate	17107625
Glioblastoma	Associate	35337344
Hyperkinesis	Associate	20648052
Intellectual Disability	Associate	20648052
Lymphatic Metastasis	Associate	36436093
Mouth Diseases	Associate	20388794
Mouth Diseases	Stimulate	25595860
Mouth Neoplasms	Associate	20647315
Nasal Polyps	Associate	16689996
Neoplasms	Associate	15294900, 20951077, 25154973, 25289898, 36436093
Neuroblastoma	Stimulate	22276108
Neuroblastoma	Associate	36419120
Obesity	Associate	26310818
Osteoarthritis Knee	Associate	27751171
Osteoporosis	Associate	37361541
Pancreatic Neoplasms	Associate	26310818
Personality Disorders	Associate	20648052
Prostatic Neoplasms	Associate	23364535
Retinoblastoma	Associate	34187205
Squamous Cell Carcinoma of Head and Neck	Associate	20951077
Thyroid Cancer Papillary	Associate	26511970
Vulvar Neoplasms	Associate	36436093

PTGER1 (prostaglandin E receptor 1)