PTGER1 (prostaglandin E receptor 1)

Gene

• Entrez ID: 5731
• Gene name: Prostaglandin E receptor 1
• Gene symbol: PTGER1
• Synonyms (NCBI Gene): EP1
• Chromosome: 19
• Chromosome location: 19p13.12
• Summary: The protein encoded by this gene is a member of the G protein-coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). Through a phosphatidylinositol-calcium second messenger system, G-Q proteins mediate this

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2080144	hsa-miR-1587	CLIP-seq
MIRT2080145	hsa-miR-1915	CLIP-seq
MIRT2080146	hsa-miR-4417	CLIP-seq
MIRT2080147	hsa-miR-4492	CLIP-seq
MIRT2080148	hsa-miR-4498	CLIP-seq
MIRT2080149	hsa-miR-4656	CLIP-seq
MIRT2080150	hsa-miR-4675	CLIP-seq
MIRT2080151	hsa-miR-4690-3p	CLIP-seq
MIRT2080152	hsa-miR-4741	CLIP-seq
MIRT2080153	hsa-miR-541	CLIP-seq
MIRT2080154	hsa-miR-654-5p	CLIP-seq
MIRT2080155	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004955	Function	Prostaglandin receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	IBA
GO:0004957	Function	Prostaglandin E receptor activity	IDA	8253813
GO:0004957	Function	Prostaglandin E receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	TAS	8253813
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8253813
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8253813
GO:0006954	Process	Inflammatory response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8253813
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8253813
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007206	Process	Phospholipase C-activating G protein-coupled glutamate receptor signaling pathway	IDA	8253813
GO:0016020	Component	Membrane	IEA
GO:0031748	Function	D1 dopamine receptor binding	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034695	Process	Response to prostaglandin E	IDA	8253813
GO:0034695	Process	Response to prostaglandin E	IDA	8253813

Other IDs

• MIM: 176802
• HGNC: 9593
• e!Ensembl: ENSG00000160951

Protein

• UniProt ID: P34995
• Protein name: Prostaglandin E2 receptor EP1 subtype (PGE receptor EP1 subtype) (PGE2 receptor EP1 subtype) (Prostanoid EP1 receptor)
• Protein function: Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	49 → 351	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Abundant in kidney. Lower level expression in lung, skeletal muscle and spleen, lowest expression in testis and not detected in liver brain and heart.
• Sequence:

  MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
  AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
  GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
  LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
  PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
  GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
  QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF

• Sequence length: 402

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Human cytomegalovirus infection
Pathways in cancer

Reactome:

Prostanoid ligand receptors
G alpha (q) signalling events