Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5730
Gene name Gene Name - the full gene name approved by the HGNC.	Prostaglandin D2 synthase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTGDS
Synonyms (NCBI Gene) Gene synonyms aliases	L-PGDS, LPGDS, PDS, PGD2, PGDS, PGDS2
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q34.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervou

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017585	hsa-miR-335-5p	Microarray	18185580
MIRT1272594	hsa-miR-1252	CLIP-seq
MIRT1272595	hsa-miR-2278	CLIP-seq
MIRT1272596	hsa-miR-4468	CLIP-seq
MIRT1272597	hsa-miR-4533	CLIP-seq
MIRT1272598	hsa-miR-4747-5p	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
HES1	Repression	15743775
NFKB1	Activation	19094210
TFAP2B	Activation	15743775
USF1	Activation	17574780
USF1	Repression	18817855

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	20347284, 20667974
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	ISS
GO:0004667	Function	Prostaglandin-D synthase activity	EXP	20667974
GO:0004667	Function	Prostaglandin-D synthase activity	IDA	20347284, 20667974
GO:0004667	Function	Prostaglandin-D synthase activity	IEA
GO:0004667	Function	Prostaglandin-D synthase activity	ISS
GO:0004667	Function	Prostaglandin-D synthase activity	TAS	1902577
GO:0005501	Function	Retinoid binding	IEA
GO:0005501	Function	Retinoid binding	ISS
GO:0005504	Function	Fatty acid binding	IDA	20667974
GO:0005515	Function	Protein binding	IPI	16713569, 25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IDA	7692978
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	19878301
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005791	Component	Rough endoplasmic reticulum	IDA	9065498
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0036094	Function	Small molecule binding	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	ISS
GO:0046457	Process	Prostanoid biosynthetic process	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

MIM	HGNC	e!Ensembl
176803	9592	ENSG00000107317

Protein

UniProt ID

P41222

Protein name

Prostaglandin-H2 D-isomerase (EC 5.3.99.2) (Beta-trace protein) (Cerebrin-28) (Glutathione-independent PGD synthase) (Lipocalin-type prostaglandin-D synthase) (L-PGDS) (Prostaglandin-D2 synthase) (PGD2 synthase) (PGDS) (PGDS2)

Protein function

Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation (PubMed:20667974). Involved in a variety of CNS functions, such as sedation, NREM sleep and

PDB

2WWP , 3O19 , 3O22 , 3O2Y , 4IMN , 4IMO , 4ORR , 4ORS , 4ORU , 4ORW , 4ORX , 4ORY , 4OS0 , 4OS3 , 4OS8 , 5WY9 , 8HTA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	40 → 184	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundant in the brain and CNS, where it is expressed in tissues of the blood-brain barrier and secreted into the cerebro-spinal fluid. Abundantly expressed in the heart. In the male reproductive system, it is expressed in the testis, e

Sequence

MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKA
ALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSV
VETDYDQYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFL
PQTDKCMTEQ

Sequence length

190

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways		Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

PTGDS (prostaglandin D2 synthase)