PTGDS (prostaglandin D2 synthase)

Gene

• Entrez ID: 5730
• Gene name: Prostaglandin D2 synthase
• Gene symbol: PTGDS
• Synonyms (NCBI Gene): L-PGDS, LPGDS, PDS, PGD2, PGDS, PGDS2
• Chromosome: 9
• Chromosome location: 9q34.3
• Summary: The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervou

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017585	hsa-miR-335-5p	Microarray	18185580
MIRT1272594	hsa-miR-1252	CLIP-seq
MIRT1272595	hsa-miR-2278	CLIP-seq
MIRT1272596	hsa-miR-4468	CLIP-seq
MIRT1272597	hsa-miR-4533	CLIP-seq
MIRT1272598	hsa-miR-4747-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HES1	Repression	15743775
NFKB1	Activation	19094210
TFAP2B	Activation	15743775
USF1	Activation	17574780
USF1	Repression	18817855

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	20347284, 20667974
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	ISS
GO:0004667	Function	Prostaglandin-D synthase activity	EXP	20667974
GO:0004667	Function	Prostaglandin-D synthase activity	IDA	20347284, 20667974
GO:0004667	Function	Prostaglandin-D synthase activity	IEA
GO:0004667	Function	Prostaglandin-D synthase activity	ISS
GO:0004667	Function	Prostaglandin-D synthase activity	TAS	1902577
GO:0005501	Function	Retinoid binding	IEA
GO:0005501	Function	Retinoid binding	ISS
GO:0005504	Function	Fatty acid binding	IDA	20667974
GO:0005515	Function	Protein binding	IPI	16713569, 25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IDA	7692978
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	19878301
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005791	Component	Rough endoplasmic reticulum	IDA	9065498
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0036094	Function	Small molecule binding	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	ISS
GO:0046457	Process	Prostanoid biosynthetic process	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

Other IDs

• MIM: 176803
• HGNC: 9592
• e!Ensembl: ENSG00000107317

Protein

• UniProt ID: P41222
• Protein name: Prostaglandin-H2 D-isomerase (EC 5.3.99.2) (Beta-trace protein) (Cerebrin-28) (Glutathione-independent PGD synthase) (Lipocalin-type prostaglandin-D synthase) (L-PGDS) (Prostaglandin-D2 synthase) (PGD2 synthase) (PGDS) (PGDS2)
• Protein function: Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation (PubMed:20667974). Involved in a variety of CNS functions, such as sedation, NREM sleep and
• PDB: 2WWP, 3O19, 3O22, 3O2Y, 4IMN, 4IMO, 4ORR, 4ORS, 4ORU, 4ORW, 4ORX, 4ORY, 4OS0, 4OS3, 4OS8, 5WY9, 8HTA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	40 → 184	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Abundant in the brain and CNS, where it is expressed in tissues of the blood-brain barrier and secreted into the cerebro-spinal fluid. Abundantly expressed in the heart. In the male reproductive system, it is expressed in the testis, e
• Sequence:

  MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKA
  ALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSV
  VETDYDQYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFL
  PQTDKCMTEQ

• Sequence length: 190

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways

Reactome:

Synthesis of Prostaglandins (PG) and Thromboxanes (TX)