Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	57175
Gene name	Coronin 1B
Gene symbol	CORO1B
Synonyms (NCBI Gene)	CORONIN-2
Chromosome	11
Chromosome location	11q13.2
Summary	Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]).[supplied by OMIM, Mar 2008]

Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020753	hsa-miR-155-5p	Proteomics	18668040
MIRT025452	hsa-miR-34a-5p	Proteomics	21566225
MIRT038589	hsa-miR-106b-3p	CLASH	23622248
MIRT036781	hsa-miR-760	CLASH	23622248
MIRT904575	hsa-miR-143	CLIP-seq
MIRT904576	hsa-miR-3150b-3p	CLIP-seq
MIRT904577	hsa-miR-3179	CLIP-seq
MIRT904578	hsa-miR-3180	CLIP-seq
MIRT904579	hsa-miR-3180-3p	CLIP-seq
MIRT904580	hsa-miR-3196	CLIP-seq
MIRT904581	hsa-miR-3202	CLIP-seq
MIRT904582	hsa-miR-3915	CLIP-seq
MIRT904583	hsa-miR-3928	CLIP-seq
MIRT904584	hsa-miR-3960	CLIP-seq
MIRT904585	hsa-miR-4467	CLIP-seq
MIRT904586	hsa-miR-4481	CLIP-seq
MIRT904587	hsa-miR-4488	CLIP-seq
MIRT904588	hsa-miR-4691-5p	CLIP-seq
MIRT904589	hsa-miR-4697-5p	CLIP-seq
MIRT904590	hsa-miR-4745-5p	CLIP-seq
MIRT904591	hsa-miR-4747-5p	CLIP-seq
MIRT904592	hsa-miR-4758-5p	CLIP-seq
MIRT904593	hsa-miR-4770	CLIP-seq
MIRT904594	hsa-miR-4784	CLIP-seq
MIRT904595	hsa-miR-493	CLIP-seq
MIRT904596	hsa-miR-658	CLIP-seq
MIRT904597	hsa-miR-765	CLIP-seq
MIRT904598	hsa-miR-873	CLIP-seq
MIRT904599	hsa-miR-1	CLIP-seq
MIRT904575	hsa-miR-143	CLIP-seq
MIRT904600	hsa-miR-206	CLIP-seq
MIRT904601	hsa-miR-3123	CLIP-seq
MIRT904576	hsa-miR-3150b-3p	CLIP-seq
MIRT904577	hsa-miR-3179	CLIP-seq
MIRT904578	hsa-miR-3180	CLIP-seq
MIRT904579	hsa-miR-3180-3p	CLIP-seq
MIRT904580	hsa-miR-3196	CLIP-seq
MIRT904581	hsa-miR-3202	CLIP-seq
MIRT904602	hsa-miR-3647-3p	CLIP-seq
MIRT904603	hsa-miR-3673	CLIP-seq
MIRT904584	hsa-miR-3960	CLIP-seq
MIRT904585	hsa-miR-4467	CLIP-seq
MIRT904586	hsa-miR-4481	CLIP-seq
MIRT904587	hsa-miR-4488	CLIP-seq
MIRT904589	hsa-miR-4697-5p	CLIP-seq
MIRT904590	hsa-miR-4745-5p	CLIP-seq
MIRT904591	hsa-miR-4747-5p	CLIP-seq
MIRT904592	hsa-miR-4758-5p	CLIP-seq
MIRT904593	hsa-miR-4770	CLIP-seq
MIRT904594	hsa-miR-4784	CLIP-seq
MIRT904595	hsa-miR-493	CLIP-seq
MIRT904604	hsa-miR-590-3p	CLIP-seq
MIRT904605	hsa-miR-613	CLIP-seq
MIRT904596	hsa-miR-658	CLIP-seq
MIRT904597	hsa-miR-765	CLIP-seq
MIRT1556194	hsa-miR-661	CLIP-seq
MIRT2204112	hsa-miR-2467-3p	CLIP-seq
MIRT2204113	hsa-miR-4419a	CLIP-seq
MIRT2204114	hsa-miR-4446-3p	CLIP-seq
MIRT2204115	hsa-miR-4468	CLIP-seq
MIRT2204116	hsa-miR-4492	CLIP-seq
MIRT2204117	hsa-miR-4498	CLIP-seq
MIRT2204118	hsa-miR-4505	CLIP-seq
MIRT2204119	hsa-miR-4510	CLIP-seq
MIRT904588	hsa-miR-4691-5p	CLIP-seq
MIRT2204120	hsa-miR-4721	CLIP-seq
MIRT2204121	hsa-miR-762	CLIP-seq
MIRT904598	hsa-miR-873	CLIP-seq
MIRT2678489	hsa-miR-1285	CLIP-seq
MIRT2678490	hsa-miR-1539	CLIP-seq
MIRT2678491	hsa-miR-2467-5p	CLIP-seq
MIRT2678492	hsa-miR-3187-5p	CLIP-seq
MIRT2678493	hsa-miR-326	CLIP-seq
MIRT2678494	hsa-miR-330-5p	CLIP-seq
MIRT2678495	hsa-miR-378g	CLIP-seq
MIRT2678496	hsa-miR-4257	CLIP-seq
MIRT2678497	hsa-miR-4486	CLIP-seq
MIRT2678498	hsa-miR-612	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IDA	16027158, 22619279
GO:0001725	Component	Stress fiber	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	16027158, 17350576, 21044950, 26655834, 28514442, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	23667561, 25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	22619279
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IDA	18775315
GO:0005886	Component	Plasma membrane	IDA	15800061
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007015	Process	Actin filament organization	IBA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IDA	16027158
GO:0030027	Component	Lamellipodium	IDA	22619279, 23667561
GO:0030027	Component	Lamellipodium	IEA
GO:0030036	Process	Actin cytoskeleton organization	IDA	18775315
GO:0031252	Component	Cell leading edge	IDA	16027158, 17456547
GO:0031529	Process	Ruffle organization	IDA	16027158
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	IC	22619279
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	IDA	17350576, 18775315
GO:0035767	Process	Endothelial cell chemotaxis	IDA	23667561
GO:0035767	Process	Endothelial cell chemotaxis	IMP	23667561
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IMP	22619279
GO:0042060	Process	Wound healing	IDA	23667561
GO:0042802	Function	Identical protein binding	IDA	16027158
GO:0045202	Component	Synapse	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22619279
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	17456547
GO:0051015	Function	Actin filament binding	IEA
GO:0051015	Function	Actin filament binding	IMP	22364218
GO:0051017	Process	Actin filament bundle assembly	IDA	17456547
GO:0051129	Process	Negative regulation of cellular component organization	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071672	Process	Negative regulation of smooth muscle cell chemotaxis	IMP	22619279
GO:0071933	Function	Arp2/3 complex binding	IDA	16027158, 18775315
GO:0071933	Function	Arp2/3 complex binding	IPI	22619279
GO:0071944	Component	Cell periphery	IDA	22619279
GO:0090135	Process	Actin filament branching	IDA	18775315
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1902463	Process	Protein localization to cell leading edge	IDA	17350576
GO:2000394	Process	Positive regulation of lamellipodium morphogenesis	IDA	17350576

MIM	HGNC	e!Ensembl
609849	2253	ENSG00000172725

Q9BR76

Protein name

Coronin-1B (Coronin-2)

Protein function

Regulates leading edge dynamics and cell motility in fibroblasts. May be involved in cytokinesis and signal transduction (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08953	DUF1899	5 → 70	Domain of unknown function (DUF1899)	Domain
PF00400	WD40	73 → 111	WD domain, G-beta repeat	Repeat
PF00400	WD40	122 → 161	WD domain, G-beta repeat	Repeat
PF00400	WD40	170 → 204	WD domain, G-beta repeat	Repeat
PF16300	WD40_4	345 → 387		Repeat

Sequence

MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAF
LVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSP
LTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFS
RMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEE
PPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQ
DDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA
PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ
LGRMENGDA

Sequence length

489

Interactions

View interactions

CORO1B (coronin 1B)