Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57162
Gene name Gene Name - the full gene name approved by the HGNC.	Pellino E3 ubiquitin protein ligase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PELI1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p14

Show/Hide all(251)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005096	hsa-miR-155-5p	Microarray	19193853
MIRT005096	hsa-miR-155-5p	Microarray	19193853
MIRT016081	hsa-miR-374b-5p	Sequencing	20371350
MIRT019644	hsa-miR-340-5p	Sequencing	20371350
MIRT005096	hsa-miR-155-5p	Proteomics	18668040
MIRT031077	hsa-miR-21-5p	Sequencing	20371350
MIRT031077	hsa-miR-21-5p	Microarray	18591254
MIRT050853	hsa-miR-17-5p	CLASH	23622248
MIRT048318	hsa-miR-106a-5p	CLASH	23622248
MIRT038510	hsa-miR-296-3p	CLASH	23622248
MIRT031077	hsa-miR-21-5p	Microarray, qRT-PCR	22815788
MIRT655295	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT655294	hsa-miR-224-5p	HITS-CLIP	23824327
MIRT655293	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT655292	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT655291	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT655290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT655289	hsa-miR-578	HITS-CLIP	23824327
MIRT031077	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT389205	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT031077	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT389205	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT655295	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT655294	hsa-miR-224-5p	HITS-CLIP	23824327
MIRT655293	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT655292	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT655291	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT655290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT655289	hsa-miR-578	HITS-CLIP	23824327
MIRT1224713	hsa-miR-105	CLIP-seq
MIRT1224714	hsa-miR-1178	CLIP-seq
MIRT1224715	hsa-miR-1185	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT1224717	hsa-miR-1237	CLIP-seq
MIRT1224718	hsa-miR-1248	CLIP-seq
MIRT1224719	hsa-miR-1253	CLIP-seq
MIRT1224720	hsa-miR-1273e	CLIP-seq
MIRT1224721	hsa-miR-1278	CLIP-seq
MIRT1224722	hsa-miR-128	CLIP-seq
MIRT1224723	hsa-miR-1284	CLIP-seq
MIRT1224724	hsa-miR-129-5p	CLIP-seq
MIRT1224725	hsa-miR-1305	CLIP-seq
MIRT1224726	hsa-miR-130a	CLIP-seq
MIRT1224727	hsa-miR-130b	CLIP-seq
MIRT1224728	hsa-miR-142-3p	CLIP-seq
MIRT1224729	hsa-miR-151-3p	CLIP-seq
MIRT1224730	hsa-miR-155	CLIP-seq
MIRT1224731	hsa-miR-185	CLIP-seq
MIRT1224732	hsa-miR-21	CLIP-seq
MIRT1224733	hsa-miR-2276	CLIP-seq
MIRT1224734	hsa-miR-2278	CLIP-seq
MIRT1224735	hsa-miR-2467-5p	CLIP-seq
MIRT1224736	hsa-miR-27a	CLIP-seq
MIRT1224737	hsa-miR-27b	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT1224739	hsa-miR-301a	CLIP-seq
MIRT1224740	hsa-miR-301b	CLIP-seq
MIRT1224741	hsa-miR-3065-3p	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT1224743	hsa-miR-3121-5p	CLIP-seq
MIRT1224744	hsa-miR-3138	CLIP-seq
MIRT1224745	hsa-miR-3150a-3p	CLIP-seq
MIRT1224746	hsa-miR-3170	CLIP-seq
MIRT1224747	hsa-miR-3171	CLIP-seq
MIRT1224748	hsa-miR-3173-3p	CLIP-seq
MIRT1224749	hsa-miR-3175	CLIP-seq
MIRT1224750	hsa-miR-340	CLIP-seq
MIRT1224751	hsa-miR-342-5p	CLIP-seq
MIRT1224752	hsa-miR-3605-5p	CLIP-seq
MIRT1224753	hsa-miR-3613-3p	CLIP-seq
MIRT1224754	hsa-miR-3615	CLIP-seq
MIRT1224755	hsa-miR-362-5p	CLIP-seq
MIRT1224756	hsa-miR-3666	CLIP-seq
MIRT1224757	hsa-miR-3679-5p	CLIP-seq
MIRT1224758	hsa-miR-3680	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224760	hsa-miR-371b-5p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT1224765	hsa-miR-3910	CLIP-seq
MIRT1224766	hsa-miR-3942-3p	CLIP-seq
MIRT1224767	hsa-miR-4263	CLIP-seq
MIRT1224768	hsa-miR-4272	CLIP-seq
MIRT1224769	hsa-miR-4279	CLIP-seq
MIRT1224770	hsa-miR-4291	CLIP-seq
MIRT1224771	hsa-miR-4295	CLIP-seq
MIRT1224772	hsa-miR-4306	CLIP-seq
MIRT1224773	hsa-miR-4328	CLIP-seq
MIRT1224774	hsa-miR-4468	CLIP-seq
MIRT1224775	hsa-miR-4476	CLIP-seq
MIRT1224776	hsa-miR-4503	CLIP-seq
MIRT1224777	hsa-miR-4509	CLIP-seq
MIRT1224778	hsa-miR-450b-5p	CLIP-seq
MIRT1224779	hsa-miR-4527	CLIP-seq
MIRT1224780	hsa-miR-4533	CLIP-seq
MIRT1224781	hsa-miR-454	CLIP-seq
MIRT1224782	hsa-miR-4540	CLIP-seq
MIRT1224783	hsa-miR-4639-5p	CLIP-seq
MIRT1224784	hsa-miR-4644	CLIP-seq
MIRT1224785	hsa-miR-4651	CLIP-seq
MIRT1224786	hsa-miR-4664-5p	CLIP-seq
MIRT1224787	hsa-miR-4671-3p	CLIP-seq
MIRT1224788	hsa-miR-4696	CLIP-seq
MIRT1224789	hsa-miR-4698	CLIP-seq
MIRT1224790	hsa-miR-4735-5p	CLIP-seq
MIRT1224791	hsa-miR-4778-3p	CLIP-seq
MIRT1224792	hsa-miR-4779	CLIP-seq
MIRT1224793	hsa-miR-4796-5p	CLIP-seq
MIRT1224794	hsa-miR-491-5p	CLIP-seq
MIRT1224795	hsa-miR-495	CLIP-seq
MIRT1224796	hsa-miR-500a	CLIP-seq
MIRT1224797	hsa-miR-500b	CLIP-seq
MIRT1224798	hsa-miR-5096	CLIP-seq
MIRT1224799	hsa-miR-511	CLIP-seq
MIRT1224800	hsa-miR-513a-3p	CLIP-seq
MIRT1224801	hsa-miR-513a-5p	CLIP-seq
MIRT1224802	hsa-miR-518a-5p	CLIP-seq
MIRT1224803	hsa-miR-527	CLIP-seq
MIRT1224804	hsa-miR-548a-3p	CLIP-seq
MIRT1224805	hsa-miR-548ae	CLIP-seq
MIRT1224806	hsa-miR-548aj	CLIP-seq
MIRT1224807	hsa-miR-548am	CLIP-seq
MIRT1224808	hsa-miR-548e	CLIP-seq
MIRT1224809	hsa-miR-548f	CLIP-seq
MIRT1224810	hsa-miR-548g	CLIP-seq
MIRT1224811	hsa-miR-548x	CLIP-seq
MIRT1224812	hsa-miR-570	CLIP-seq
MIRT1224813	hsa-miR-574-3p	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224815	hsa-miR-590-5p	CLIP-seq
MIRT1224816	hsa-miR-607	CLIP-seq
MIRT1224817	hsa-miR-608	CLIP-seq
MIRT1224818	hsa-miR-654-3p	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq
MIRT1224820	hsa-miR-891b	CLIP-seq
MIRT1224821	hsa-miR-939	CLIP-seq
MIRT1224714	hsa-miR-1178	CLIP-seq
MIRT1224720	hsa-miR-1273e	CLIP-seq
MIRT1224724	hsa-miR-129-5p	CLIP-seq
MIRT2065548	hsa-miR-139-5p	CLIP-seq
MIRT1224732	hsa-miR-21	CLIP-seq
MIRT2065549	hsa-miR-221	CLIP-seq
MIRT2065550	hsa-miR-222	CLIP-seq
MIRT2065551	hsa-miR-223	CLIP-seq
MIRT1224733	hsa-miR-2276	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT2065552	hsa-miR-302f	CLIP-seq
MIRT2065553	hsa-miR-3121-3p	CLIP-seq
MIRT1224743	hsa-miR-3121-5p	CLIP-seq
MIRT1224750	hsa-miR-340	CLIP-seq
MIRT1224758	hsa-miR-3680	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT1224766	hsa-miR-3942-3p	CLIP-seq
MIRT1224767	hsa-miR-4263	CLIP-seq
MIRT2065554	hsa-miR-4521	CLIP-seq
MIRT1224782	hsa-miR-4540	CLIP-seq
MIRT2065555	hsa-miR-4666-3p	CLIP-seq
MIRT2065556	hsa-miR-4678	CLIP-seq
MIRT1224788	hsa-miR-4696	CLIP-seq
MIRT2065557	hsa-miR-4789-5p	CLIP-seq
MIRT2065558	hsa-miR-4795-3p	CLIP-seq
MIRT1224800	hsa-miR-513a-3p	CLIP-seq
MIRT2065559	hsa-miR-543	CLIP-seq
MIRT2065560	hsa-miR-548ag	CLIP-seq
MIRT2065561	hsa-miR-548ai	CLIP-seq
MIRT2065562	hsa-miR-548v	CLIP-seq
MIRT1224815	hsa-miR-590-5p	CLIP-seq
MIRT2065563	hsa-miR-935	CLIP-seq
MIRT2293423	hsa-miR-101	CLIP-seq
MIRT1224720	hsa-miR-1273e	CLIP-seq
MIRT1224743	hsa-miR-3121-5p	CLIP-seq
MIRT1224766	hsa-miR-3942-3p	CLIP-seq
MIRT2293424	hsa-miR-4709-5p	CLIP-seq
MIRT1224810	hsa-miR-548g	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT2432103	hsa-miR-3129-3p	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT2432104	hsa-miR-499-3p	CLIP-seq
MIRT2432105	hsa-miR-499a-3p	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT2439396	hsa-miR-4324	CLIP-seq
MIRT2439397	hsa-miR-4765	CLIP-seq
MIRT2439398	hsa-miR-544b	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT2591423	hsa-miR-153	CLIP-seq
MIRT2591424	hsa-miR-2681	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT2065553	hsa-miR-3121-3p	CLIP-seq
MIRT2432103	hsa-miR-3129-3p	CLIP-seq
MIRT2591425	hsa-miR-3163	CLIP-seq
MIRT2591426	hsa-miR-3616-5p	CLIP-seq
MIRT2591427	hsa-miR-3647-5p	CLIP-seq
MIRT2591428	hsa-miR-3662	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT1224767	hsa-miR-4263	CLIP-seq
MIRT2439396	hsa-miR-4324	CLIP-seq
MIRT2591429	hsa-miR-448	CLIP-seq
MIRT2065554	hsa-miR-4521	CLIP-seq
MIRT2065556	hsa-miR-4678	CLIP-seq
MIRT2591430	hsa-miR-4760-3p	CLIP-seq
MIRT2439397	hsa-miR-4765	CLIP-seq
MIRT2591431	hsa-miR-4777-5p	CLIP-seq
MIRT2432104	hsa-miR-499-3p	CLIP-seq
MIRT2432105	hsa-miR-499a-3p	CLIP-seq
MIRT2065559	hsa-miR-543	CLIP-seq
MIRT2439398	hsa-miR-544b	CLIP-seq
MIRT2591432	hsa-miR-548ac	CLIP-seq
MIRT1224805	hsa-miR-548ae	CLIP-seq
MIRT2065560	hsa-miR-548ag	CLIP-seq
MIRT2065561	hsa-miR-548ai	CLIP-seq
MIRT1224806	hsa-miR-548aj	CLIP-seq
MIRT1224807	hsa-miR-548am	CLIP-seq
MIRT2591433	hsa-miR-548d-3p	CLIP-seq
MIRT1224811	hsa-miR-548x	CLIP-seq
MIRT2591434	hsa-miR-548z	CLIP-seq
MIRT2591435	hsa-miR-573	CLIP-seq
MIRT2591436	hsa-miR-577	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT2432103	hsa-miR-3129-3p	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT2439396	hsa-miR-4324	CLIP-seq
MIRT2439397	hsa-miR-4765	CLIP-seq
MIRT2432104	hsa-miR-499-3p	CLIP-seq
MIRT2432105	hsa-miR-499a-3p	CLIP-seq
MIRT2439398	hsa-miR-544b	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq

Show/Hide all(50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	30952868
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	12496252, 16884718, 19264966, 25416956, 29883609, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IC	33215753
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008592	Process	Regulation of Toll signaling pathway	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0032496	Process	Response to lipopolysaccharide	IDA	19193853
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034141	Process	Positive regulation of toll-like receptor 3 signaling pathway	IEA
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	30952868
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	TAS
GO:0035861	Component	Site of double-strand break	IDA	30952868
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0042098	Process	T cell proliferation	IEA
GO:0042110	Process	T cell activation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	29883609
GO:0043331	Process	Response to dsRNA	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050871	Process	Positive regulation of B cell activation	IEA
GO:0060544	Process	Regulation of necroptotic process	TAS
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IMP	29883609
GO:0061630	Function	Ubiquitin protein ligase activity	EXP	29883609
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	29883609, 30952868
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	30952868, 33215753
GO:0070534	Process	Protein K63-linked ubiquitination	IMP	29883609
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IMP	29883609
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	12172553
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	33215753
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	12172553
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	30952868

MIM	HGNC	e!Ensembl
614797	8827	ENSG00000197329

Protein

UniProt ID

Q96FA3

Protein name

E3 ubiquitin-protein ligase pellino homolog 1 (Pellino-1) (EC 2.3.2.27) (Pellino-related intracellular-signaling molecule) (RING-type E3 ubiquitin transferase pellino homolog 1)

Protein function

E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed:12496252, PubMed:17675297, PubMed:29883609, PubMed:30952868). Involved in the TLR and IL-1 signaling pathways via interaction with the c

PDB

9IF9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04710	Pellino	8 → 418	Pellino	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in normal skin but decreased in keratinocytes from toxic epidermal necrolysis (TEN) patients (at protein level). {ECO:0000269|PubMed:29883609}.

Sequence

MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIA
CTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPG
SQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQM
DGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQD
GSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVV
DEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPP
THAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

Sequence length

418

Interactions

View interactions

	Reactome
			Interleukin-1 signaling IRAK1 recruits IKK complex IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	27248820
Alzheimer Disease	Associate	36982982
Asthma	Associate	28223794
Bone Marrow Diseases	Stimulate	27469333
Breast Neoplasms	Associate	35105803
Burkitt Lymphoma	Stimulate	27469333
Carcinogenesis	Associate	27248820
COVID 19	Associate	34193364
Down Syndrome	Associate	31843015
Esophageal Neoplasms	Associate	32925794
Esophageal Squamous Cell Carcinoma	Associate	34738714
Giant Cell Arteritis	Associate	34204585
Inflammation	Associate	27469333
Lung Neoplasms	Associate	27248820
Lupus Erythematosus Systemic	Associate	34931135
Lymphoma B Cell	Stimulate	27469333
Lymphoma Large B Cell Diffuse	Associate	27469333
Mucocutaneous Lymph Node Syndrome	Associate	34193364
Neoplasms	Associate	34738714
Neoplasms Squamous Cell	Associate	34738714
Plasmablastic Lymphoma	Stimulate	27469333
Pulmonary Disease Chronic Obstructive	Associate	23384071, 35308900
Pulmonary Disease Chronic Obstructive	Stimulate	28223794
Retinitis Pigmentosa	Associate	15215745

PELI1 (pellino E3 ubiquitin protein ligase 1)