PELI1 (pellino E3 ubiquitin protein ligase 1)

Gene

• Entrez ID: 57162
• Gene name: Pellino E3 ubiquitin protein ligase 1
• Gene symbol: PELI1
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2p14

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005096	hsa-miR-155-5p	Microarray	19193853
MIRT005096	hsa-miR-155-5p	Microarray	19193853
MIRT016081	hsa-miR-374b-5p	Sequencing	20371350
MIRT019644	hsa-miR-340-5p	Sequencing	20371350
MIRT005096	hsa-miR-155-5p	Proteomics	18668040
MIRT031077	hsa-miR-21-5p	Sequencing	20371350
MIRT031077	hsa-miR-21-5p	Microarray	18591254
MIRT050853	hsa-miR-17-5p	CLASH	23622248
MIRT048318	hsa-miR-106a-5p	CLASH	23622248
MIRT038510	hsa-miR-296-3p	CLASH	23622248
MIRT031077	hsa-miR-21-5p	Microarray, qRT-PCR	22815788
MIRT655295	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT655294	hsa-miR-224-5p	HITS-CLIP	23824327
MIRT655293	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT655292	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT655291	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT655290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT655289	hsa-miR-578	HITS-CLIP	23824327
MIRT031077	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT389205	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT031077	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT389205	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT655295	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT655294	hsa-miR-224-5p	HITS-CLIP	23824327
MIRT655293	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT655292	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT655291	hsa-miR-668-3p	HITS-CLIP	23824327
MIRT655290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT655289	hsa-miR-578	HITS-CLIP	23824327
MIRT1224713	hsa-miR-105	CLIP-seq
MIRT1224714	hsa-miR-1178	CLIP-seq
MIRT1224715	hsa-miR-1185	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT1224717	hsa-miR-1237	CLIP-seq
MIRT1224718	hsa-miR-1248	CLIP-seq
MIRT1224719	hsa-miR-1253	CLIP-seq
MIRT1224720	hsa-miR-1273e	CLIP-seq
MIRT1224721	hsa-miR-1278	CLIP-seq
MIRT1224722	hsa-miR-128	CLIP-seq
MIRT1224723	hsa-miR-1284	CLIP-seq
MIRT1224724	hsa-miR-129-5p	CLIP-seq
MIRT1224725	hsa-miR-1305	CLIP-seq
MIRT1224726	hsa-miR-130a	CLIP-seq
MIRT1224727	hsa-miR-130b	CLIP-seq
MIRT1224728	hsa-miR-142-3p	CLIP-seq
MIRT1224729	hsa-miR-151-3p	CLIP-seq
MIRT1224730	hsa-miR-155	CLIP-seq
MIRT1224731	hsa-miR-185	CLIP-seq
MIRT1224732	hsa-miR-21	CLIP-seq
MIRT1224733	hsa-miR-2276	CLIP-seq
MIRT1224734	hsa-miR-2278	CLIP-seq
MIRT1224735	hsa-miR-2467-5p	CLIP-seq
MIRT1224736	hsa-miR-27a	CLIP-seq
MIRT1224737	hsa-miR-27b	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT1224739	hsa-miR-301a	CLIP-seq
MIRT1224740	hsa-miR-301b	CLIP-seq
MIRT1224741	hsa-miR-3065-3p	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT1224743	hsa-miR-3121-5p	CLIP-seq
MIRT1224744	hsa-miR-3138	CLIP-seq
MIRT1224745	hsa-miR-3150a-3p	CLIP-seq
MIRT1224746	hsa-miR-3170	CLIP-seq
MIRT1224747	hsa-miR-3171	CLIP-seq
MIRT1224748	hsa-miR-3173-3p	CLIP-seq
MIRT1224749	hsa-miR-3175	CLIP-seq
MIRT1224750	hsa-miR-340	CLIP-seq
MIRT1224751	hsa-miR-342-5p	CLIP-seq
MIRT1224752	hsa-miR-3605-5p	CLIP-seq
MIRT1224753	hsa-miR-3613-3p	CLIP-seq
MIRT1224754	hsa-miR-3615	CLIP-seq
MIRT1224755	hsa-miR-362-5p	CLIP-seq
MIRT1224756	hsa-miR-3666	CLIP-seq
MIRT1224757	hsa-miR-3679-5p	CLIP-seq
MIRT1224758	hsa-miR-3680	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224760	hsa-miR-371b-5p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT1224765	hsa-miR-3910	CLIP-seq
MIRT1224766	hsa-miR-3942-3p	CLIP-seq
MIRT1224767	hsa-miR-4263	CLIP-seq
MIRT1224768	hsa-miR-4272	CLIP-seq
MIRT1224769	hsa-miR-4279	CLIP-seq
MIRT1224770	hsa-miR-4291	CLIP-seq
MIRT1224771	hsa-miR-4295	CLIP-seq
MIRT1224772	hsa-miR-4306	CLIP-seq
MIRT1224773	hsa-miR-4328	CLIP-seq
MIRT1224774	hsa-miR-4468	CLIP-seq
MIRT1224775	hsa-miR-4476	CLIP-seq
MIRT1224776	hsa-miR-4503	CLIP-seq
MIRT1224777	hsa-miR-4509	CLIP-seq
MIRT1224778	hsa-miR-450b-5p	CLIP-seq
MIRT1224779	hsa-miR-4527	CLIP-seq
MIRT1224780	hsa-miR-4533	CLIP-seq
MIRT1224781	hsa-miR-454	CLIP-seq
MIRT1224782	hsa-miR-4540	CLIP-seq
MIRT1224783	hsa-miR-4639-5p	CLIP-seq
MIRT1224784	hsa-miR-4644	CLIP-seq
MIRT1224785	hsa-miR-4651	CLIP-seq
MIRT1224786	hsa-miR-4664-5p	CLIP-seq
MIRT1224787	hsa-miR-4671-3p	CLIP-seq
MIRT1224788	hsa-miR-4696	CLIP-seq
MIRT1224789	hsa-miR-4698	CLIP-seq
MIRT1224790	hsa-miR-4735-5p	CLIP-seq
MIRT1224791	hsa-miR-4778-3p	CLIP-seq
MIRT1224792	hsa-miR-4779	CLIP-seq
MIRT1224793	hsa-miR-4796-5p	CLIP-seq
MIRT1224794	hsa-miR-491-5p	CLIP-seq
MIRT1224795	hsa-miR-495	CLIP-seq
MIRT1224796	hsa-miR-500a	CLIP-seq
MIRT1224797	hsa-miR-500b	CLIP-seq
MIRT1224798	hsa-miR-5096	CLIP-seq
MIRT1224799	hsa-miR-511	CLIP-seq
MIRT1224800	hsa-miR-513a-3p	CLIP-seq
MIRT1224801	hsa-miR-513a-5p	CLIP-seq
MIRT1224802	hsa-miR-518a-5p	CLIP-seq
MIRT1224803	hsa-miR-527	CLIP-seq
MIRT1224804	hsa-miR-548a-3p	CLIP-seq
MIRT1224805	hsa-miR-548ae	CLIP-seq
MIRT1224806	hsa-miR-548aj	CLIP-seq
MIRT1224807	hsa-miR-548am	CLIP-seq
MIRT1224808	hsa-miR-548e	CLIP-seq
MIRT1224809	hsa-miR-548f	CLIP-seq
MIRT1224810	hsa-miR-548g	CLIP-seq
MIRT1224811	hsa-miR-548x	CLIP-seq
MIRT1224812	hsa-miR-570	CLIP-seq
MIRT1224813	hsa-miR-574-3p	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224815	hsa-miR-590-5p	CLIP-seq
MIRT1224816	hsa-miR-607	CLIP-seq
MIRT1224817	hsa-miR-608	CLIP-seq
MIRT1224818	hsa-miR-654-3p	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq
MIRT1224820	hsa-miR-891b	CLIP-seq
MIRT1224821	hsa-miR-939	CLIP-seq
MIRT1224714	hsa-miR-1178	CLIP-seq
MIRT1224720	hsa-miR-1273e	CLIP-seq
MIRT1224724	hsa-miR-129-5p	CLIP-seq
MIRT2065548	hsa-miR-139-5p	CLIP-seq
MIRT1224732	hsa-miR-21	CLIP-seq
MIRT2065549	hsa-miR-221	CLIP-seq
MIRT2065550	hsa-miR-222	CLIP-seq
MIRT2065551	hsa-miR-223	CLIP-seq
MIRT1224733	hsa-miR-2276	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT2065552	hsa-miR-302f	CLIP-seq
MIRT2065553	hsa-miR-3121-3p	CLIP-seq
MIRT1224743	hsa-miR-3121-5p	CLIP-seq
MIRT1224750	hsa-miR-340	CLIP-seq
MIRT1224758	hsa-miR-3680	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT1224766	hsa-miR-3942-3p	CLIP-seq
MIRT1224767	hsa-miR-4263	CLIP-seq
MIRT2065554	hsa-miR-4521	CLIP-seq
MIRT1224782	hsa-miR-4540	CLIP-seq
MIRT2065555	hsa-miR-4666-3p	CLIP-seq
MIRT2065556	hsa-miR-4678	CLIP-seq
MIRT1224788	hsa-miR-4696	CLIP-seq
MIRT2065557	hsa-miR-4789-5p	CLIP-seq
MIRT2065558	hsa-miR-4795-3p	CLIP-seq
MIRT1224800	hsa-miR-513a-3p	CLIP-seq
MIRT2065559	hsa-miR-543	CLIP-seq
MIRT2065560	hsa-miR-548ag	CLIP-seq
MIRT2065561	hsa-miR-548ai	CLIP-seq
MIRT2065562	hsa-miR-548v	CLIP-seq
MIRT1224815	hsa-miR-590-5p	CLIP-seq
MIRT2065563	hsa-miR-935	CLIP-seq
MIRT2293423	hsa-miR-101	CLIP-seq
MIRT1224720	hsa-miR-1273e	CLIP-seq
MIRT1224743	hsa-miR-3121-5p	CLIP-seq
MIRT1224766	hsa-miR-3942-3p	CLIP-seq
MIRT2293424	hsa-miR-4709-5p	CLIP-seq
MIRT1224810	hsa-miR-548g	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT2432103	hsa-miR-3129-3p	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT2432104	hsa-miR-499-3p	CLIP-seq
MIRT2432105	hsa-miR-499a-3p	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT2439396	hsa-miR-4324	CLIP-seq
MIRT2439397	hsa-miR-4765	CLIP-seq
MIRT2439398	hsa-miR-544b	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT2591423	hsa-miR-153	CLIP-seq
MIRT2591424	hsa-miR-2681	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT2065553	hsa-miR-3121-3p	CLIP-seq
MIRT2432103	hsa-miR-3129-3p	CLIP-seq
MIRT2591425	hsa-miR-3163	CLIP-seq
MIRT2591426	hsa-miR-3616-5p	CLIP-seq
MIRT2591427	hsa-miR-3647-5p	CLIP-seq
MIRT2591428	hsa-miR-3662	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT1224767	hsa-miR-4263	CLIP-seq
MIRT2439396	hsa-miR-4324	CLIP-seq
MIRT2591429	hsa-miR-448	CLIP-seq
MIRT2065554	hsa-miR-4521	CLIP-seq
MIRT2065556	hsa-miR-4678	CLIP-seq
MIRT2591430	hsa-miR-4760-3p	CLIP-seq
MIRT2439397	hsa-miR-4765	CLIP-seq
MIRT2591431	hsa-miR-4777-5p	CLIP-seq
MIRT2432104	hsa-miR-499-3p	CLIP-seq
MIRT2432105	hsa-miR-499a-3p	CLIP-seq
MIRT2065559	hsa-miR-543	CLIP-seq
MIRT2439398	hsa-miR-544b	CLIP-seq
MIRT2591432	hsa-miR-548ac	CLIP-seq
MIRT1224805	hsa-miR-548ae	CLIP-seq
MIRT2065560	hsa-miR-548ag	CLIP-seq
MIRT2065561	hsa-miR-548ai	CLIP-seq
MIRT1224806	hsa-miR-548aj	CLIP-seq
MIRT1224807	hsa-miR-548am	CLIP-seq
MIRT2591433	hsa-miR-548d-3p	CLIP-seq
MIRT1224811	hsa-miR-548x	CLIP-seq
MIRT2591434	hsa-miR-548z	CLIP-seq
MIRT2591435	hsa-miR-573	CLIP-seq
MIRT2591436	hsa-miR-577	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq
MIRT1224716	hsa-miR-1200	CLIP-seq
MIRT1224738	hsa-miR-300	CLIP-seq
MIRT1224742	hsa-miR-3074-5p	CLIP-seq
MIRT2432103	hsa-miR-3129-3p	CLIP-seq
MIRT1224759	hsa-miR-369-3p	CLIP-seq
MIRT1224761	hsa-miR-374a	CLIP-seq
MIRT1224762	hsa-miR-374b	CLIP-seq
MIRT1224763	hsa-miR-374c	CLIP-seq
MIRT1224764	hsa-miR-381	CLIP-seq
MIRT2439396	hsa-miR-4324	CLIP-seq
MIRT2439397	hsa-miR-4765	CLIP-seq
MIRT2432104	hsa-miR-499-3p	CLIP-seq
MIRT2432105	hsa-miR-499a-3p	CLIP-seq
MIRT2439398	hsa-miR-544b	CLIP-seq
MIRT1224814	hsa-miR-586	CLIP-seq
MIRT1224819	hsa-miR-655	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	30952868
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	12496252, 16884718, 19264966, 25416956, 29883609, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IC	33215753
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008592	Process	Regulation of Toll signaling pathway	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0032496	Process	Response to lipopolysaccharide	IDA	19193853
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034141	Process	Positive regulation of toll-like receptor 3 signaling pathway	IEA
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	30952868
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	TAS
GO:0035861	Component	Site of double-strand break	IDA	30952868
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0042098	Process	T cell proliferation	IEA
GO:0042110	Process	T cell activation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	29883609
GO:0043331	Process	Response to dsRNA	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050871	Process	Positive regulation of B cell activation	IEA
GO:0060544	Process	Regulation of necroptotic process	TAS
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IMP	29883609
GO:0061630	Function	Ubiquitin protein ligase activity	EXP	29883609
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	29883609, 30952868
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	30952868, 33215753
GO:0070534	Process	Protein K63-linked ubiquitination	IMP	29883609
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IMP	29883609
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	12172553
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	33215753
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	12172553
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	30952868

Other IDs

• MIM: 614797
• HGNC: 8827
• e!Ensembl: ENSG00000197329

Protein

• UniProt ID: Q96FA3
• Protein name: E3 ubiquitin-protein ligase pellino homolog 1 (Pellino-1) (EC 2.3.2.27) (Pellino-related intracellular-signaling molecule) (RING-type E3 ubiquitin transferase pellino homolog 1)
• Protein function: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed:12496252, PubMed:17675297, PubMed:29883609, PubMed:30952868). Involved in the TLR and IL-1 signaling pathways via interaction with the c
• PDB: 9IF9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04710	Pellino	8 → 418	Pellino	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in normal skin but decreased in keratinocytes from toxic epidermal necrolysis (TEN) patients (at protein level). {ECO:0000269|PubMed:29883609}.
• Sequence:

  MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIA
  CTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPG
  SQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQM
  DGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQD
  GSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVV
  DEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPP
  THAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

• Sequence length: 418

Pathways

Reactome:

Interleukin-1 signaling
IRAK1 recruits IKK complex
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation