RGL3 (ral guanine nucleotide dissociation stimulator like 3)

Gene

• Entrez ID: 57139
• Gene name: Ral guanine nucleotide dissociation stimulator like 3
• Gene symbol: RGL3
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2089933	hsa-miR-1226	CLIP-seq
MIRT2089934	hsa-miR-3670	CLIP-seq
MIRT2089935	hsa-miR-4691-3p	CLIP-seq
MIRT2314769	hsa-miR-128	CLIP-seq
MIRT2314770	hsa-miR-1343	CLIP-seq
MIRT2314771	hsa-miR-3150a-3p	CLIP-seq
MIRT2314772	hsa-miR-3175	CLIP-seq
MIRT2314773	hsa-miR-326	CLIP-seq
MIRT2314774	hsa-miR-330-5p	CLIP-seq
MIRT2314775	hsa-miR-3663-5p	CLIP-seq
MIRT2314776	hsa-miR-3677-5p	CLIP-seq
MIRT2314777	hsa-miR-4667-5p	CLIP-seq
MIRT2314778	hsa-miR-4672	CLIP-seq
MIRT2314779	hsa-miR-4700-5p	CLIP-seq
MIRT2314780	hsa-miR-4728-5p	CLIP-seq
MIRT2314781	hsa-miR-4757-5p	CLIP-seq
MIRT2314782	hsa-miR-4768-5p	CLIP-seq
MIRT2314783	hsa-miR-618	CLIP-seq
MIRT2314784	hsa-miR-637	CLIP-seq
MIRT2314785	hsa-miR-668	CLIP-seq
MIRT2314786	hsa-miR-939	CLIP-seq
MIRT2089933	hsa-miR-1226	CLIP-seq
MIRT2089934	hsa-miR-3670	CLIP-seq
MIRT2089935	hsa-miR-4691-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0031267	Function	Small GTPase binding	IEA

Other IDs

• MIM: 616743
• HGNC: 30282
• e!Ensembl: ENSG00000205517

Protein

• UniProt ID: Q3MIN7
• Protein name: Ral guanine nucleotide dissociation stimulator-like 3 (RalGDS-like 3)
• Protein function: Guanine nucleotide exchange factor (GEF) for Ral-A. Potential effector of GTPase HRas and Ras-related protein M-Ras. Negatively regulates Elk-1-dependent gene induction downstream of HRas and MEKK1 (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00618	RasGEF_N	68 → 174	RasGEF N-terminal motif	Domain
  PF00617	RasGEF	250 → 453	RasGEF domain	Family
  PF00788	RA	613 → 700	Ras association (RalGDS/AF-6) domain	Domain

• Sequence:

  MERTAGKELALAPLQDWGEETEDGAVYSVSLRRQRSQRRSPAEGPGGSQAPSPIANTFLH
  YRTSKVRVLRAARLERLVGELVFGDREQDPSFMPAFLATYRTFVPTACLLGFLLPPMPPP
  PPPGVEIKKTAVQDLSFNKNLRAVVSVLGSWLQDHPQDFRDPPAHSDLGSVRTFLGWAAP
  GSAEAQKAEKLLEDFLEEAEREQEEEPPQVWTGPPRVAQTSDPDSSEACAEEEEGLMPQG
  PQLLDFSVDEVAEQLTLIDLELFSKVRLYECLGSVWSQRDRPGAAGASPTVRATVAQFNT
  VTGCVLGSVLGAPGLAAPQRAQRLEKWIRIAQRCRELRNFSSLRAILSALQSNPIYRLKR
  SWGAVSREPLSTFRKLSQIFSDENNHLSSREILFQEEATEGSQEEDNTPGSLPSKPPPGP
  VPYLGTFLTDLVMLDTALPDMLEGDLINFEKRRKEWEILARIQQLQRRCQSYTLSPHPPI
  LAALHAQNQLTEEQSYRLSRVIEPPAASCPSSPRIRRRISLTKRLSAKLAREKSSSPSGS
  PGDPSSPTSSVSPGSPPSSPRSRDAPAGSPPASPGPQGPSTKLPLSLDLPSPRPFALPLG
  SPRIPLPAQQSSEARVIRVSIDNDHGNLYRSILLTSQDKAPSVVRRALQKHNVPQPWACD
  YQLFQVLPGDRVLLIPDNANVFYAMSPVAPRDFMLRRKEGTRNTLSVSPS

• Sequence length: 710

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PREGNANCY-INDUCED	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Glaucoma	Associate	36833422	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Associate	36833422	★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	37175507	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pre Eclampsia	Associate	37285119	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Associate	37176017	★☆☆☆☆ Found in Text Mining only