Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56990
Gene name Gene Name - the full gene name approved by the HGNC.
CDC42 small effector 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDC42SE2
Synonyms (NCBI Gene) Gene synonyms aliases
SPEC2
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039379 hsa-miR-421 CLASH 23622248
MIRT039379 hsa-miR-421 CLASH 23622248
MIRT256320 hsa-miR-6838-5p PAR-CLIP 21572407
MIRT256305 hsa-miR-15a-5p PAR-CLIP 21572407
MIRT256309 hsa-miR-15b-5p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001891 Component Phagocytic cup IEA
GO:0005515 Function Protein binding IPI 10816584
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005886 Component Plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619457 18547 ENSG00000158985
Protein
UniProt ID Q9NRR3
Protein name CDC42 small effector protein 2 (Small effector of CDC42 protein 2)
Protein function Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulatio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00786 PBD 28 52 P21-Rho-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in T-lymphocytes. Highly expressed in CCRF-CEM T-lymphocytes, Jurkat T-lymphocytes, and Raji B-lymphocytes compared (at protein level). {ECO:0000269|PubMed:15840583}.
Sequence
MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQM
QSKGGYGGGMPANVQMQLVDTKAG
Sequence length 84
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Astrocytoma Associate 37280243
Colorectal Neoplasms Associate 26515597