OLFML3 (olfactomedin like 3)

Gene

• Entrez ID: 56944
• Gene name: Olfactomedin like 3
• Gene symbol: OLFML3
• Synonyms (NCBI Gene): HNOEL-iso, OLF44
• Chromosome: 1
• Chromosome location: 1p13.2
• Summary: This gene encodes a member of the olfactomedin-like gene family which also includes genes encoding noelin, tiarin, myocilin, amassin, optimedin, photomedin, and latrophilin. The encoded protein is a secreted extracellular matrix glycoprotein with a C-term

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017928	hsa-miR-335-5p	Microarray	18185580
MIRT1203277	hsa-miR-193a-3p	CLIP-seq
MIRT1203278	hsa-miR-193b	CLIP-seq
MIRT1203279	hsa-miR-3125	CLIP-seq
MIRT1203280	hsa-miR-3136-3p	CLIP-seq
MIRT1203281	hsa-miR-3916	CLIP-seq
MIRT1203282	hsa-miR-4293	CLIP-seq
MIRT1203283	hsa-miR-486-3p	CLIP-seq
MIRT1203284	hsa-miR-596	CLIP-seq
MIRT1203285	hsa-miR-877	CLIP-seq
MIRT2058701	hsa-miR-4722-5p	CLIP-seq
MIRT1203280	hsa-miR-3136-3p	CLIP-seq
MIRT2585209	hsa-miR-3185	CLIP-seq
MIRT2585210	hsa-miR-3591-5p	CLIP-seq
MIRT2585211	hsa-miR-369-3p	CLIP-seq
MIRT2585212	hsa-miR-374a	CLIP-seq
MIRT2585213	hsa-miR-374b	CLIP-seq
MIRT2585214	hsa-miR-3915	CLIP-seq
MIRT2585215	hsa-miR-3928	CLIP-seq
MIRT2585216	hsa-miR-4450	CLIP-seq
MIRT2585217	hsa-miR-4460	CLIP-seq
MIRT2585218	hsa-miR-4709-3p	CLIP-seq
MIRT2585219	hsa-miR-4727-3p	CLIP-seq
MIRT2585220	hsa-miR-491-5p	CLIP-seq
MIRT1203280	hsa-miR-3136-3p	CLIP-seq
MIRT2585209	hsa-miR-3185	CLIP-seq
MIRT2585210	hsa-miR-3591-5p	CLIP-seq
MIRT2585211	hsa-miR-369-3p	CLIP-seq
MIRT2585212	hsa-miR-374a	CLIP-seq
MIRT2585213	hsa-miR-374b	CLIP-seq
MIRT2585214	hsa-miR-3915	CLIP-seq
MIRT2585215	hsa-miR-3928	CLIP-seq
MIRT2585216	hsa-miR-4450	CLIP-seq
MIRT2585217	hsa-miR-4460	CLIP-seq
MIRT2585218	hsa-miR-4709-3p	CLIP-seq
MIRT2585219	hsa-miR-4727-3p	CLIP-seq
MIRT2585220	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0007165	Process	Signal transduction	IBA
GO:1903561	Component	Extracellular vesicle	HDA	24769233

Other IDs

• MIM: 610088
• HGNC: 24956
• e!Ensembl: ENSG00000116774

Protein

• UniProt ID: Q9NRN5
• Protein name: Olfactomedin-like protein 3 (HNOEL-iso) (hOLF44)
• Protein function: Secreted scaffold protein that plays an essential role in dorsoventral patterning during early development. Stabilizes axial formation by restricting chordin (CHRD) activity on the dorsal side. Acts by facilitating the association between the to
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02191	OLF	139 → 399	Olfactomedin-like domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Abundant in placenta, moderate in liver and heart, whereas fairly weak in other tissues examined. On term placenta, mainly localized extracellularly surrounding the syncytiotrophoblastic cells and very rarely expressed in the maternal
• Sequence:

  MGPSTPLLILFLLSWSGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKN
  KMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTK
  GKGRRNEKYDMVTDCGYTISQVRSMKILKRFGGPAGLWTKDPLGQTEKIYVLDGTQNDTA
  FVFPRLRDFTLAMAARKASRVRVPFPWVGTGQLVYGGFLYFARRPPGRPGGGGEMENTLQ
  LIKFHLANRTVVDSSVFPAEGLIPPYGLTADTYIDLAADEEGLWAVYATREDDRHLCLAK
  LDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFDASGTLTPERA
  ALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEV

• Sequence length: 406

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alzheimer Disease	Associate	32711556, 39380021	★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	40285515	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Inhibit	40285515	★☆☆☆☆ Found in Text Mining only