Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	56925
Gene name	Latexin
Gene symbol	LXN
Synonyms (NCBI Gene)	ECITCI
Chromosome	3
Chromosome location	3q25.32
Summary	This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. The encoded protein, latexin, downregulates the population size of hematopoietic stem cells. This protein is found to be downregulated in cancer cells because o

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049272	hsa-miR-92a-3p	CLASH	23622248
MIRT1122687	hsa-miR-106a	CLIP-seq
MIRT1122688	hsa-miR-106b	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122690	hsa-miR-145	CLIP-seq
MIRT1122691	hsa-miR-17	CLIP-seq
MIRT1122692	hsa-miR-1825	CLIP-seq
MIRT1122693	hsa-miR-199a-5p	CLIP-seq
MIRT1122694	hsa-miR-199b-5p	CLIP-seq
MIRT1122695	hsa-miR-20a	CLIP-seq
MIRT1122696	hsa-miR-20b	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122699	hsa-miR-3149	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT1122701	hsa-miR-3609	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122703	hsa-miR-410	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT1122705	hsa-miR-4729	CLIP-seq
MIRT1122706	hsa-miR-4796-3p	CLIP-seq
MIRT1122707	hsa-miR-519d	CLIP-seq
MIRT1122708	hsa-miR-548ah	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT1122710	hsa-miR-93	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT2034678	hsa-miR-3617	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT2034679	hsa-miR-4757-5p	CLIP-seq
MIRT2034680	hsa-miR-641	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT2564194	hsa-miR-1183	CLIP-seq
MIRT2564195	hsa-miR-1284	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122699	hsa-miR-3149	CLIP-seq
MIRT2564196	hsa-miR-3168	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT2564197	hsa-miR-4642	CLIP-seq
MIRT2034679	hsa-miR-4757-5p	CLIP-seq
MIRT2564198	hsa-miR-561	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT2564194	hsa-miR-1183	CLIP-seq
MIRT2564195	hsa-miR-1284	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122699	hsa-miR-3149	CLIP-seq
MIRT2564196	hsa-miR-3168	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT2564197	hsa-miR-4642	CLIP-seq
MIRT2034679	hsa-miR-4757-5p	CLIP-seq
MIRT2564198	hsa-miR-561	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
KLF4	Repression	23364479
NANOG	Repression	23364479

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA

MIM	HGNC	e!Ensembl
609305	13347	ENSG00000079257

Q9BS40

Protein name

Latexin (Endogenous carboxypeptidase inhibitor) (ECI) (Protein MUM) (Tissue carboxypeptidase inhibitor) (TCI)

Protein function

Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. May play a role in inflammation.

PDB

2BO9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06907	Latexin	3 → 219	Latexin	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, prostate, ovary, kidney, pancreas, and colon, moderate or low in other tissues including brain. {ECO:0000269|PubMed:11455960}.

Sequence

MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEE
IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQ
NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY
TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

Sequence length

222

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
See cases	Uncertain significance	rs745485339	RCV001197651

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	30914656
Carcinoma Pancreatic Ductal	Inhibit	26530530
Diabetes Mellitus Type 2	Associate	35271662
Endometriosis	Associate	39202445
Exocrine Pancreatic Insufficiency	Associate	33857242
Inflammation	Associate	30914656
Medulloblastoma	Associate	18664619
Mouth Diseases	Stimulate	39202445
Neoplasm Metastasis	Inhibit	26530530
Neoplasms	Associate	18664619, 26252227
Neoplasms	Inhibit	26530530, 30914656, 36681316
Osteoarthritis	Associate	36949500
Pancreatic Neoplasms	Associate	26530530
Sarcopenia	Associate	35271662
Wounds and Injuries	Associate	36949500

LXN (latexin)