Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56923
Gene name Gene Name - the full gene name approved by the HGNC.	Neuromedin U receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NMUR2
Synonyms (NCBI Gene) Gene synonyms aliases	FM-4, FM4, NMU-R2, NMU2R, TGR-1, TGR1
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q33.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein from the G-protein coupled receptor 1 family. This protein is a receptor for neuromedin U, which is a neuropeptide that is widely distributed in the gut and central nervous system. This receptor plays an important role in the r

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT2054521	hsa-miR-532-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq
MIRT2283590	hsa-miR-3065-3p	CLIP-seq
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT2283591	hsa-miR-3688-3p	CLIP-seq
MIRT2283592	hsa-miR-4282	CLIP-seq
MIRT2283593	hsa-miR-4291	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT2054521	hsa-miR-532-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq
MIRT2283594	hsa-miR-587	CLIP-seq
MIRT2283595	hsa-miR-885-5p	CLIP-seq
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001607	Function	Neuromedin U receptor activity	IDA	10887190, 10894543
GO:0002023	Process	Reduction of food intake in response to dietary excess	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10894543
GO:0005229	Function	Intracellular calcium activated chloride channel activity	IDA	10899166
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005525	Function	GTP binding	IDA	10899166
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006816	Process	Calcium ion transport	IDA	10899166
GO:0006940	Process	Regulation of smooth muscle contraction	NAS	10887190
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	10899166
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	10899166
GO:0007218	Process	Neuropeptide signaling pathway	IDA	10894543
GO:0007267	Process	Cell-cell signaling	TAS	10894543
GO:0007417	Process	Central nervous system development	IEP	10899166
GO:0007625	Process	Grooming behavior	IEA
GO:0007631	Process	Feeding behavior	TAS	10894543
GO:0016021	Component	Integral component of membrane	IDA	10899166
GO:0019722	Process	Calcium-mediated signaling	NAS	10899166
GO:0042924	Function	Neuromedin U binding	IDA	10894543, 10899166
GO:0043006	Process	Activation of phospholipase A2 activity by calcium-mediated signaling	IDA	10899166
GO:0048016	Process	Inositol phosphate-mediated signaling	IDA	10899166
GO:0048265	Process	Response to pain	IEA
GO:0050482	Process	Arachidonic acid secretion	IDA	10887190
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605108	16454	ENSG00000132911

Protein

UniProt ID

Q9GZQ4

Protein name

Neuromedin-U receptor 2 (NMU-R2) (G-protein coupled receptor FM-4) (G-protein coupled receptor TGR-1)

Protein function

Receptor for the neuromedin-U and neuromedin-S neuropeptides.

PDB

7W55 , 7W57 , 7XK8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	62 → 327	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in the CNS, particularly in the medulla oblongata, pontine reticular formation, spinal cord, and thalamus. High level in testis whereas lower levels are present in a variety of peripheral tissues including the g

Sequence

MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV
IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY
FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP
NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA
LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES
LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA
QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT

Sequence length

415

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (q) signalling events G alpha (i) signalling events

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Migraine	Migraine Disorders	rs794727411	30266756

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Alcoholism	Associate	21876473
Asthma	Associate	36543808
Breast Neoplasms	Associate	28423716
Carcinogenesis	Associate	26317338
Colorectal Neoplasms	Associate	34493299
Obesity	Associate	36232539
Osteoarthritis	Associate	36232539
Ovarian Neoplasms	Associate	26317338
Pulmonary Disease Chronic Obstructive	Inhibit	36543808
Rotator Cuff Injuries	Associate	30424787
Tukel syndrome	Associate	28423716

NMUR2 (neuromedin U receptor 2)