Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56892
Gene name Gene Name - the full gene name approved by the HGNC.	Transcriptional and immune response regulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TCIM
Synonyms (NCBI Gene) Gene synonyms aliases	C8orf4, TC-1, TC1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a small, monomeric, predominantly unstructured protein that functions as a positive regulator of the Wnt/beta-catenin signaling pathway. This protein interacts with a repressor of beta-catenin mediated transcription at nuclear speckles.

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002264	Process	Endothelial cell activation involved in immune response	IBA
GO:0002264	Process	Endothelial cell activation involved in immune response	IDA	19684084
GO:0005112	Function	Notch binding	IBA
GO:0005112	Function	Notch binding	IPI	25985737
GO:0005515	Function	Protein binding	IPI	16424001, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16424001, 17603013
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	16424001
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	16424001, 17603013
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	17603013
GO:0006915	Process	Apoptotic process	IEA
GO:0010739	Process	Positive regulation of protein kinase A signaling	IDA	15087392
GO:0016607	Component	Nuclear speck	IDA	16424001
GO:0016607	Component	Nuclear speck	IEA
GO:0034605	Process	Cellular response to heat	IDA	17603013
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15087392
GO:0045746	Process	Negative regulation of Notch signaling pathway	IBA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IDA	25985737
GO:1900020	Process	Positive regulation of protein kinase C activity	IDA	15087392
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	19684084
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IDA	18959821
GO:1903706	Process	Regulation of hemopoiesis	IEA

MIM	HGNC	e!Ensembl
607702	1357	ENSG00000176907

Protein

UniProt ID

Q9NR00

Protein name

Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)

Protein function

Seems to be involved in the regulation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1 (PubMed:16424001,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15063	TC1	10 → 85	Thyroid cancer protein 1	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Expressed in thyroid papillary carcinoma. Expressed in liver, expression levels decrease in hepatocellular carcinoma (PubMed:25985737). Slightly detected in normal lung, its expression is highly induced in lung cancer cells

Sequence

MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKA
EERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH

Sequence length

106

Interactions

View interactions

TCIM (transcriptional and immune response regulator)