Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56848
Gene name Gene Name - the full gene name approved by the HGNC.
Sphingosine kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPHK2
Synonyms (NCBI Gene) Gene synonyms aliases
SK 2, SK-2, SPK 2, SPK-2
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of two sphingosine kinase isozymes that catalyze the phosphorylation of sphingosine into sphingosine 1-phosphate. Sphingosine 1-phosphate mediates many cellular processes including migration, proliferation and apoptosis, and also pla
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045673 hsa-miR-149-5p CLASH 23622248
MIRT755431 hsa-miR-137 Luciferase reporter assay, Western blotting, qRT-PCR 37533491
MIRT755431 hsa-miR-137 Luciferase reporter assay, Western blotting, qRT-PCR 37533491
MIRT1383900 hsa-miR-1193 CLIP-seq
MIRT1383901 hsa-miR-1343 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000786 Component Nucleosome IDA 19729656
GO:0001568 Process Blood vessel development IEA
GO:0001727 Function Lipid kinase activity TAS
GO:0002720 Process Positive regulation of cytokine production involved in immune response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607092 18859 ENSG00000063176
Protein
UniProt ID Q9NRA0
Protein name Sphingosine kinase 2 (SK 2) (SPK 2) (EC 2.7.1.91)
Protein function Catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-dihydrosphingosine, D-erythro-sphingosine and L-threo-dihydrosphingosine. B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00781 DAGK_cat 182 321 Diacylglycerol kinase catalytic domain Family
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in adult kidney, liver, and brain (PubMed:10751414). Expressed in cerebral cortex and hippocampus (at protein level) (PubMed:29615132). Isoform 1 is the predominant form expressed in most tissues (PubMed:16103110). {EC
Sequence
MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSV
TLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP
Sequence length 654
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Efferocytosis
VEGF signaling pathway
Apelin signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
  Sphingolipid de novo biosynthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 29615132
Amyotrophic Lateral Sclerosis Associate 29576321
Breast Neoplasms Associate 15951439, 17311928, 20335228, 24422628, 24486401, 30423315
Carcinogenesis Associate 27588496
Carcinoma Hepatocellular Associate 29321083
Carcinoma Merkel Cell Associate 30399362
Carcinoma Non Small Cell Lung Associate 23918304, 26054751, 26628299, 40007122
Carcinoma Ovarian Epithelial Associate 32796926
Cell Transformation Neoplastic Associate 23112854
Chondrosarcoma Associate 31809267