Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56848
Gene name Gene Name - the full gene name approved by the HGNC.	Sphingosine kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SPHK2
Synonyms (NCBI Gene) Gene synonyms aliases	SK 2, SK-2, SPK 2, SPK-2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of two sphingosine kinase isozymes that catalyze the phosphorylation of sphingosine into sphingosine 1-phosphate. Sphingosine 1-phosphate mediates many cellular processes including migration, proliferation and apoptosis, and also pla

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045673	hsa-miR-149-5p	CLASH	23622248
MIRT755431	hsa-miR-137	Luciferase reporter assay, Western blotting, qRT-PCR	37533491
MIRT755431	hsa-miR-137	Luciferase reporter assay, Western blotting, qRT-PCR	37533491
MIRT1383900	hsa-miR-1193	CLIP-seq
MIRT1383901	hsa-miR-1343	CLIP-seq
MIRT1383902	hsa-miR-1587	CLIP-seq
MIRT1383903	hsa-miR-1913	CLIP-seq
MIRT1383904	hsa-miR-3180	CLIP-seq
MIRT1383905	hsa-miR-3180-3p	CLIP-seq
MIRT1383906	hsa-miR-3187-3p	CLIP-seq
MIRT1383907	hsa-miR-3196	CLIP-seq
MIRT1383908	hsa-miR-324-3p	CLIP-seq
MIRT1383909	hsa-miR-3612	CLIP-seq
MIRT1383910	hsa-miR-3675-5p	CLIP-seq
MIRT1383911	hsa-miR-3681	CLIP-seq
MIRT1383912	hsa-miR-3691-5p	CLIP-seq
MIRT1383913	hsa-miR-378g	CLIP-seq
MIRT1383914	hsa-miR-4421	CLIP-seq
MIRT1383915	hsa-miR-4435	CLIP-seq
MIRT1383916	hsa-miR-4443	CLIP-seq
MIRT1383917	hsa-miR-4492	CLIP-seq
MIRT1383918	hsa-miR-4498	CLIP-seq
MIRT1383919	hsa-miR-4649-5p	CLIP-seq
MIRT1383920	hsa-miR-4656	CLIP-seq
MIRT1383921	hsa-miR-4667-3p	CLIP-seq
MIRT1383922	hsa-miR-4675	CLIP-seq
MIRT1383923	hsa-miR-4694-3p	CLIP-seq
MIRT1383924	hsa-miR-4701-5p	CLIP-seq
MIRT1383925	hsa-miR-4734	CLIP-seq
MIRT1383926	hsa-miR-4741	CLIP-seq
MIRT1383927	hsa-miR-4749-3p	CLIP-seq
MIRT1383928	hsa-miR-4767	CLIP-seq
MIRT1383929	hsa-miR-4802-5p	CLIP-seq
MIRT1383930	hsa-miR-485-5p	CLIP-seq
MIRT1383931	hsa-miR-509-3p	CLIP-seq
MIRT1383932	hsa-miR-522	CLIP-seq
MIRT1383933	hsa-miR-548s	CLIP-seq
MIRT1383934	hsa-miR-588	CLIP-seq
MIRT1383935	hsa-miR-604	CLIP-seq
MIRT1383936	hsa-miR-616	CLIP-seq
MIRT1383937	hsa-miR-650	CLIP-seq
MIRT1383938	hsa-miR-762	CLIP-seq
MIRT2114898	hsa-miR-1	CLIP-seq
MIRT2114899	hsa-miR-206	CLIP-seq
MIRT2114900	hsa-miR-3673	CLIP-seq
MIRT2114901	hsa-miR-3680	CLIP-seq
MIRT2114902	hsa-miR-4420	CLIP-seq
MIRT2114903	hsa-miR-613	CLIP-seq

Show/Hide all(58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IDA	19729656
GO:0001727	Function	Lipid kinase activity	IBA	21873635
GO:0002367	Process	Cytokine production involved in immune response	ISS
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0003951	Function	NAD+ kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11777919, 18263879, 19729656, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	17635916, 29615132
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	17635916, 29615132
GO:0005739	Component	Mitochondrion	ISS
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005829	Component	Cytosol	IDA	10751414
GO:0005829	Component	Cytosol	TAS
GO:0006665	Process	Sphingolipid metabolic process	IBA	21873635
GO:0006669	Process	Sphinganine-1-phosphate biosynthetic process	IBA	21873635
GO:0006669	Process	Sphinganine-1-phosphate biosynthetic process	IDA	10751414, 19729656
GO:0006670	Process	Sphingosine metabolic process	ISS
GO:0008481	Function	Sphinganine kinase activity	IDA	19729656
GO:0016020	Component	Membrane	IBA	21873635
GO:0016020	Component	Membrane	IDA	10751414
GO:0016310	Process	Phosphorylation	IBA	21873635
GO:0017050	Function	D-erythro-sphingosine kinase activity	IBA	21873635
GO:0017050	Function	D-erythro-sphingosine kinase activity	IDA	10751414
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030308	Process	Negative regulation of cell growth	ISS
GO:0031064	Process	Negative regulation of histone deacetylation	IDA	19729656
GO:0031267	Function	Small GTPase binding	NAS	12391145
GO:0031493	Function	Nucleosomal histone binding	IDA	19729656
GO:0032616	Process	Interleukin-13 production	ISS
GO:0032635	Process	Interleukin-6 production	ISS
GO:0032640	Process	Tumor necrosis factor production	ISS
GO:0033008	Process	Positive regulation of mast cell activation involved in immune response	ISS
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IMP	23106337
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16118219
GO:0043122	Process	Regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA	21873635
GO:0043306	Process	Positive regulation of mast cell degranulation	ISS
GO:0043977	Process	Histone H2A-K5 acetylation	IDA	19729656
GO:0043980	Process	Histone H2B-K12 acetylation	IDA	19729656
GO:0045815	Process	Positive regulation of gene expression, epigenetic	IDA	19729656
GO:0046512	Process	Sphingosine biosynthetic process	IBA	21873635
GO:0046512	Process	Sphingosine biosynthetic process	IGI	23106337
GO:0046512	Process	Sphingosine biosynthetic process	IMP	23106337
GO:0046834	Process	Lipid phosphorylation	IEA
GO:0090037	Process	Positive regulation of protein kinase C signaling	ISS
GO:0090280	Process	Positive regulation of calcium ion import	ISS
GO:1901726	Process	Negative regulation of histone deacetylase activity	IDA	19729656
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	ISS
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IDA	17635916
GO:1904959	Process	Regulation of cytochrome-c oxidase activity	IMP	20959514
GO:2000304	Process	Positive regulation of ceramide biosynthetic process	IDA	16118219
GO:2000617	Process	Positive regulation of histone H3-K9 acetylation	IDA	19729656
GO:2001169	Process	Regulation of ATP biosynthetic process	ISS

MIM	HGNC	e!Ensembl
607092	18859	ENSG00000063176

Protein

UniProt ID

Q9NRA0

Protein name

Sphingosine kinase 2 (SK 2) (SPK 2) (EC 2.7.1.91)

Protein function

Catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-dihydrosphingosine, D-erythro-sphingosine and L-threo-dihydrosphingosine. B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00781	DAGK_cat	182 → 321	Diacylglycerol kinase catalytic domain	Family

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in adult kidney, liver, and brain (PubMed:10751414). Expressed in cerebral cortex and hippocampus (at protein level) (PubMed:29615132). Isoform 1 is the predominant form expressed in most tissues (PubMed:16103110). {EC

Sequence

MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP

Sequence length

654

Interactions

View interactions

	KEGG		Reactome
	Sphingolipid metabolism Metabolic pathways Calcium signaling pathway Sphingolipid signaling pathway Phospholipase D signaling pathway Efferocytosis VEGF signaling pathway Apelin signaling pathway Fc gamma R-mediated phagocytosis Tuberculosis		Sphingolipid de novo biosynthesis

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Psoriasis	Psoriasis			GWAS

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	29615132
Amyotrophic Lateral Sclerosis	Associate	29576321
Breast Neoplasms	Associate	15951439, 17311928, 20335228, 24422628, 24486401, 30423315
Carcinogenesis	Associate	27588496
Carcinoma Hepatocellular	Associate	29321083
Carcinoma Merkel Cell	Associate	30399362
Carcinoma Non Small Cell Lung	Associate	23918304, 26054751, 26628299, 40007122
Carcinoma Ovarian Epithelial	Associate	32796926
Cell Transformation Neoplastic	Associate	23112854
Chondrosarcoma	Associate	31809267
Colorectal Neoplasms	Associate	26733171, 34639107
Drug Related Side Effects and Adverse Reactions	Associate	32581406, 38487884
Glioblastoma	Associate	24903384, 37258577
Glioma	Associate	22288844
Hypoxia	Stimulate	19240180
Hypoxia Brain	Associate	22288844
Influenza Human	Associate	36070294
Leiomyoma	Associate	33500141
Leukemia Large Granular Lymphocytic	Associate	32124438
Lymphoma Primary Effusion	Associate	24140934, 25010828
Malformations of Cortical Development Group I	Inhibit	36975444
Mitochondrial Diseases	Associate	36975444
Mouth Neoplasms	Inhibit	35268676
Multiple Myeloma	Associate	36975444
Neoplasms	Associate	21896638, 23918304, 24455688, 24903384, 25010828, 26054751, 26209696, 26224479, 26628299, 26733171, 30423315, 36975444
Neoplasms	Stimulate	27588496, 32124438
Neurotoxicity Syndromes	Associate	38487884
Ovarian Neoplasms	Associate	32796926
Pancreatic Neoplasms	Associate	27517489
Parkinson Disease	Associate	25310737
Plaque Amyloid	Associate	29615132
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	25226616
Pulmonary Disease Chronic Obstructive	Associate	26485657
Retinal Dysplasia	Stimulate	23918304
Synovitis	Associate	29968759
Thyroid Cancer Papillary	Associate	28975989
Urinary Bladder Neoplasms	Associate	26224479

SPHK2 (sphingosine kinase 2)