Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56672
Gene name Gene Name - the full gene name approved by the HGNC.
A-kinase interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AKIP1
Synonyms (NCBI Gene) Gene synonyms aliases
BCA3, C11orf17
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants hav
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT036485 hsa-miR-1226-3p CLASH 23622248
MIRT680293 hsa-miR-4733-5p HITS-CLIP 23824327
MIRT680292 hsa-miR-6499-5p HITS-CLIP 23824327
MIRT680291 hsa-miR-4284 HITS-CLIP 23824327
MIRT680290 hsa-miR-24-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15630084, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
GO:0005654 Component Nucleoplasm IDA
GO:0034446 Process Substrate adhesion-dependent cell spreading IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609191 1170 ENSG00000166452
Protein
UniProt ID Q9NQ31
Protein name A-kinase-interacting protein 1 (Breast cancer-associated gene 3 protein) (PKA-interacting protein) (Proline-rich protein BCA3)
Protein function Enhances NF-kappa-B transcriptional activity by regulating the nuclear localization of the NF-kappa-B subunit RELA and promoting the phosphorylation of RELA by PRKACA. Regulates the effect of the cAMP-dependent protein kinase signaling pathway o
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in adult heart and at lower levels in brain, testis, ovary and skeletal muscle. Up-regulated in some breast cancer cell lines. Isoform 1 and isoform 3 are expressed in fetal brain. {ECO:0000269|PubMed:12527432,
Sequence
MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLE
KQPAAGPQRVLPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYH
RGESKLHMCLDIGNGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTY
SVTVGSNDLTKKTHVVAVDSGQSVDLVFPV
Sequence length 210
Interactions View interactions
<