TRIM39 (tripartite motif containing 39)

Gene

• Entrez ID: 56658
• Gene name: Tripartite motif containing 39
• Gene symbol: TRIM39
• Synonyms (NCBI Gene): RNF23, TFP, TRIM39B
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identifi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT652199	hsa-miR-1470	HITS-CLIP	23824327
MIRT652198	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT652197	hsa-miR-5193	HITS-CLIP	23824327
MIRT652196	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT652195	hsa-miR-4469	HITS-CLIP	23824327
MIRT652194	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT496706	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496705	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496704	hsa-miR-940	PAR-CLIP	22291592
MIRT496703	hsa-miR-4742-5p	PAR-CLIP	22291592
MIRT496702	hsa-miR-1827	PAR-CLIP	22291592
MIRT496701	hsa-miR-6866-5p	PAR-CLIP	22291592
MIRT439391	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439391	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT652199	hsa-miR-1470	HITS-CLIP	23824327
MIRT652198	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT652197	hsa-miR-5193	HITS-CLIP	23824327
MIRT652196	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT652195	hsa-miR-4469	HITS-CLIP	23824327
MIRT652194	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT496706	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496705	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496704	hsa-miR-940	PAR-CLIP	22291592
MIRT496703	hsa-miR-4742-5p	PAR-CLIP	22291592
MIRT496702	hsa-miR-1827	PAR-CLIP	22291592
MIRT496701	hsa-miR-6866-5p	PAR-CLIP	22291592
MIRT1454659	hsa-miR-1237	CLIP-seq
MIRT1454660	hsa-miR-1238	CLIP-seq
MIRT1454661	hsa-miR-1248	CLIP-seq
MIRT1454662	hsa-miR-3064-3p	CLIP-seq
MIRT1454663	hsa-miR-3124-3p	CLIP-seq
MIRT1454664	hsa-miR-3133	CLIP-seq
MIRT1454665	hsa-miR-3157-5p	CLIP-seq
MIRT1454666	hsa-miR-3160-5p	CLIP-seq
MIRT1454667	hsa-miR-3176	CLIP-seq
MIRT1454668	hsa-miR-345	CLIP-seq
MIRT1454669	hsa-miR-3685	CLIP-seq
MIRT1454670	hsa-miR-382	CLIP-seq
MIRT1454671	hsa-miR-3922-3p	CLIP-seq
MIRT1454672	hsa-miR-3926	CLIP-seq
MIRT1454673	hsa-miR-3973	CLIP-seq
MIRT1454674	hsa-miR-3976	CLIP-seq
MIRT1454675	hsa-miR-4286	CLIP-seq
MIRT1454676	hsa-miR-4305	CLIP-seq
MIRT1454677	hsa-miR-4712-3p	CLIP-seq
MIRT1454678	hsa-miR-4713-5p	CLIP-seq
MIRT1454679	hsa-miR-4715-3p	CLIP-seq
MIRT1454680	hsa-miR-4753-3p	CLIP-seq
MIRT1454681	hsa-miR-548b-3p	CLIP-seq
MIRT1454682	hsa-miR-548l	CLIP-seq
MIRT1454683	hsa-miR-548s	CLIP-seq
MIRT1454684	hsa-miR-942	CLIP-seq
MIRT1454685	hsa-miR-1207-5p	CLIP-seq
MIRT1454686	hsa-miR-124	CLIP-seq
MIRT1454687	hsa-miR-1267	CLIP-seq
MIRT1454688	hsa-miR-1292	CLIP-seq
MIRT1454689	hsa-miR-140-3p	CLIP-seq
MIRT1454662	hsa-miR-3064-3p	CLIP-seq
MIRT1454664	hsa-miR-3133	CLIP-seq
MIRT1454690	hsa-miR-3150b-3p	CLIP-seq
MIRT1454691	hsa-miR-3620	CLIP-seq
MIRT1454692	hsa-miR-3649	CLIP-seq
MIRT1454693	hsa-miR-3660	CLIP-seq
MIRT1454694	hsa-miR-3661	CLIP-seq
MIRT1454695	hsa-miR-378	CLIP-seq
MIRT1454696	hsa-miR-378b	CLIP-seq
MIRT1454697	hsa-miR-378c	CLIP-seq
MIRT1454698	hsa-miR-378d	CLIP-seq
MIRT1454699	hsa-miR-378e	CLIP-seq
MIRT1454700	hsa-miR-378f	CLIP-seq
MIRT1454701	hsa-miR-378h	CLIP-seq
MIRT1454702	hsa-miR-378i	CLIP-seq
MIRT1454703	hsa-miR-3928	CLIP-seq
MIRT1454704	hsa-miR-3929	CLIP-seq
MIRT1454674	hsa-miR-3976	CLIP-seq
MIRT1454705	hsa-miR-422a	CLIP-seq
MIRT1454706	hsa-miR-4266	CLIP-seq
MIRT1454707	hsa-miR-4267	CLIP-seq
MIRT1454708	hsa-miR-4279	CLIP-seq
MIRT1454675	hsa-miR-4286	CLIP-seq
MIRT1454709	hsa-miR-4419b	CLIP-seq
MIRT1454710	hsa-miR-4471	CLIP-seq
MIRT1454711	hsa-miR-4478	CLIP-seq
MIRT1454712	hsa-miR-4493	CLIP-seq
MIRT1454713	hsa-miR-4526	CLIP-seq
MIRT1454714	hsa-miR-4536	CLIP-seq
MIRT1454715	hsa-miR-4638-3p	CLIP-seq
MIRT1454716	hsa-miR-4645-3p	CLIP-seq
MIRT1454717	hsa-miR-4646-5p	CLIP-seq
MIRT1454718	hsa-miR-4649-3p	CLIP-seq
MIRT1454719	hsa-miR-4695-5p	CLIP-seq
MIRT1454679	hsa-miR-4715-3p	CLIP-seq
MIRT1454720	hsa-miR-4732-3p	CLIP-seq
MIRT1454721	hsa-miR-4763-3p	CLIP-seq
MIRT1454722	hsa-miR-4779	CLIP-seq
MIRT1454723	hsa-miR-4784	CLIP-seq
MIRT1454724	hsa-miR-492	CLIP-seq
MIRT1454725	hsa-miR-506	CLIP-seq
MIRT1454726	hsa-miR-548ag	CLIP-seq
MIRT1454727	hsa-miR-548ai	CLIP-seq
MIRT1454681	hsa-miR-548b-3p	CLIP-seq
MIRT1454728	hsa-miR-548m	CLIP-seq
MIRT1454729	hsa-miR-631	CLIP-seq
MIRT1454730	hsa-miR-765	CLIP-seq
MIRT2136200	hsa-miR-516b	CLIP-seq
MIRT1454685	hsa-miR-1207-5p	CLIP-seq
MIRT1454688	hsa-miR-1292	CLIP-seq
MIRT2650865	hsa-miR-1913	CLIP-seq
MIRT2650866	hsa-miR-204	CLIP-seq
MIRT2650867	hsa-miR-211	CLIP-seq
MIRT2650868	hsa-miR-216b	CLIP-seq
MIRT2650869	hsa-miR-2964a-5p	CLIP-seq
MIRT2650870	hsa-miR-3122	CLIP-seq
MIRT1454666	hsa-miR-3160-5p	CLIP-seq
MIRT2650871	hsa-miR-3189-3p	CLIP-seq
MIRT2650872	hsa-miR-324-3p	CLIP-seq
MIRT2650873	hsa-miR-3614-3p	CLIP-seq
MIRT1454692	hsa-miR-3649	CLIP-seq
MIRT1454694	hsa-miR-3661	CLIP-seq
MIRT2650874	hsa-miR-3689a-3p	CLIP-seq
MIRT2650875	hsa-miR-3689c	CLIP-seq
MIRT2650876	hsa-miR-3691-3p	CLIP-seq
MIRT2650877	hsa-miR-3913-5p	CLIP-seq
MIRT1454704	hsa-miR-3929	CLIP-seq
MIRT1454674	hsa-miR-3976	CLIP-seq
MIRT1454708	hsa-miR-4279	CLIP-seq
MIRT2650878	hsa-miR-4290	CLIP-seq
MIRT2650879	hsa-miR-4312	CLIP-seq
MIRT1454709	hsa-miR-4419b	CLIP-seq
MIRT1454710	hsa-miR-4471	CLIP-seq
MIRT1454711	hsa-miR-4478	CLIP-seq
MIRT1454712	hsa-miR-4493	CLIP-seq
MIRT2650880	hsa-miR-4522	CLIP-seq
MIRT1454718	hsa-miR-4649-3p	CLIP-seq
MIRT2650881	hsa-miR-4725-5p	CLIP-seq
MIRT2650882	hsa-miR-4755-5p	CLIP-seq
MIRT1454721	hsa-miR-4763-3p	CLIP-seq
MIRT2650883	hsa-miR-4780	CLIP-seq
MIRT1454724	hsa-miR-492	CLIP-seq
MIRT2650884	hsa-miR-504	CLIP-seq
MIRT2650885	hsa-miR-548ae	CLIP-seq
MIRT2650886	hsa-miR-548aj	CLIP-seq
MIRT2650887	hsa-miR-548am	CLIP-seq
MIRT2650888	hsa-miR-548x	CLIP-seq
MIRT2650889	hsa-miR-623	CLIP-seq
MIRT1454729	hsa-miR-631	CLIP-seq
MIRT2650890	hsa-miR-653	CLIP-seq
MIRT2650891	hsa-miR-802	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 17474147, 19100260, 19549727, 21516116, 22493164, 23213251, 25416956, 25910212, 26363554, 27107012, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	23213251
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	19100260
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	19100260
GO:0005829	Component	Cytosol	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	23213251
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	23213251
GO:0042802	Function	Identical protein binding	IPI	16189514, 21516116, 22493164, 25416956, 32296183
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	26363554
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IBA
GO:0050821	Process	Protein stabilization	IMP	23213251, 26363554
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IMP	23213251
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	19100260
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IBA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	19100260

Other IDs

• MIM: 605700
• HGNC: 10065
• e!Ensembl: ENSG00000204599

Protein

• UniProt ID: Q9HCM9
• Protein name: E3 ubiquitin-protein ligase TRIM39 (EC 2.3.2.27) (RING finger protein 23) (RING-type E3 ubiquitin transferase TRIM39) (Testis-abundant finger protein) (Tripartite motif-containing protein 39)
• Protein function: [Isoform 1]: E3 ubiquitin-protein ligase (PubMed:22529100). May facilitate apoptosis by inhibiting APC/C-Cdh1-mediated poly-ubiquitination and subsequent proteasome-mediated degradation of the pro-apoptotic protein MOAP1 (PubMed:19100260, PubMed
• PDB: 2DID, 2DIF, 2ECJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15227	zf-C3HC4_4	29 → 69		Domain
  PF00643	zf-B_box	102 → 143	B-box zinc finger	Domain
  PF13765	PRY	339 → 388	SPRY-associated domain	Family
  PF00622	SPRY	392 → 509	SPRY domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous; highly expressed in brain, heart, kidney, liver, skeletal muscle, spleen and testis. {ECO:0000269|PubMed:19100260}.
• Sequence:

  MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
  ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYE
  DQEAVCLICAISHTHRAHTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPG
  ELKRLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDL
  AHLAAEVEGKCLQSGFEMLKDVKSTLEKNIPRKFGGSLSTICPRDHKALLGLVKEINRCE
  KVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKSVK
  FVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGEL
  TPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHI
  YTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE

• Sequence length: 518

Pathways

Reactome:

Antigen processing: Ubiquitination & Proteasome degradation