Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56652
Gene name Gene Name - the full gene name approved by the HGNC.
Twinkle mtDNA helicase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TWNK
Synonyms (NCBI Gene) Gene synonyms aliases
ATXN8, C10orf2, IOSCA, MTDPS7, PEO, PEO1, PEOA3, PRLTS5, SANDO, SCA8, TWINL
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a hexameric DNA helicase which unwinds short stretches of double-stranded DNA in the 5` to 3` direction and, along with mitochondrial single-stranded DNA binding protein and mtDNA polymerase gamma, is thought to play a key role in mtDNA
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs80356540 A>G Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs80356541 C>T Pathogenic Intron variant, synonymous variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant
rs80356544 C>T Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs111033572 G>C Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs111033574 G>A,C,T Pathogenic Stop gained, missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT528625 hsa-miR-4747-3p PAR-CLIP 22012620
MIRT528624 hsa-miR-4717-3p PAR-CLIP 22012620
MIRT528623 hsa-miR-4267 PAR-CLIP 22012620
MIRT528622 hsa-miR-6741-3p PAR-CLIP 22012620
MIRT528621 hsa-miR-4638-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000262 Component Mitochondrial chromosome IDA 26253742
GO:0002020 Function Protease binding IPI 14739292
GO:0003678 Function DNA helicase activity IBA
GO:0003678 Function DNA helicase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606075 1160 ENSG00000107815
Protein
UniProt ID Q96RR1
Protein name Twinkle mtDNA helicase (EC 5.6.2.3) (Progressive external ophthalmoplegia 1 protein) (T7 gp4-like protein with intramitochondrial nucleoid localization) (T7-like mitochondrial DNA helicase) (Twinkle protein, mitochondrial)
Protein function [Isoform 1]: Mitochondrial helicase involved in mtDNA replication and repair (PubMed:12975372, PubMed:15167897, PubMed:17324440, PubMed:18039713, PubMed:18971204, PubMed:25824949, PubMed:26887820, PubMed:27226550). Might have a role in mtDNA rep
PDB 7T8B , 7T8C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13481 AAA_25 374 564 Domain
Tissue specificity TISSUE SPECIFICITY: High relative levels in skeletal muscle, testis and pancreas. Lower levels of expression in the heart, brain, placenta, lung, liver, kidney, spleen, thymus, prostate, ovary, small intestine, colon and leukocytes. Expression is coregula
Sequence
MWVLLRSGYPLRILLPLRGEWMGRRGLPRNLAPGPPRRRYRKETLQALDMPVLPVTATEI
RQYLRGHGIPFQDGHSCLRALSPFAESSQLKGQTGVTTSFSLFIDKTTGHFLCMTSLAEG
SWEDFQASVEGRGDGAREGFLLSKAPEFEDSEEVRRIWNRAIPLWELPDQEEVQLADTMF
GLTKVTDDTLKRFSVRYLRPARSLVFPWFSPGGSGLRGLKLLEAKCQGDGVSYEETTIPR
PSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTGLPTLTLPRGTTCLPPALLPYLEQ
FRRIVFWLGDDLRSWEAAKLFARKLNPKRCFLVRPGDQQPRPLEALNGGFNLSRILRTAL
PAWHKSIVSFRQLREEVLGELSNVEQAAGLRWSRFPDLNRILKGHRKGELTVFTGPTGSG
KTTFISEYALDLCSQGVNTLWGSFEISNVRLARVMLTQFAEGRLEDQLDKYDHWADRFED
LPLYFMTFHGQQSIRTVIDTMQHAVYVYDICHVIIDNLQFMMGHEQLSTDRIAAQDYIIG
VFRKFATDNNCHVTLVIHPRKEDD
DKELQTASIFGSAKASQEADNVLILQDRKLVTGPGK
RYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGAT
TQNSEICSGQAPTPDQPDTSKRSK
Sequence length 684
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spinocerebellar ataxia   Transcriptional activation of mitochondrial biogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ataxia neuropathy spectrum disorder sensory ataxic neuropathy, dysarthria, and ophthalmoparesis rs80356543 N/A
Fatal Mitochondrial Disease Mitochondrial disease rs111033577, rs28937887, rs1554887097, rs1554887213, rs111033573, rs1554887222 N/A
progressive external ophthalmoplegia with mitochondrial dna deletions Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal dominant 1, Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal dominant 3 rs111033574, rs28937887, rs1554887097, rs111033572, rs111033579, rs111033573, rs80356543, rs1554887213, rs111033575, rs758026634, rs111033576, rs267606682, rs111033577 N/A
Spinocerebellar Ataxia infantile onset spinocerebellar ataxia rs779142717, rs863223919, rs781016340, rs886037832, rs1366090807, rs28937887, rs80356544, rs1564808324, rs80356540, rs1590020571, rs80356542 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cerebellar Ataxia Autosomal recessive cerebellar ataxia N/A N/A ClinVar
External ophthalmoplegia autosomal dominant progressive external ophthalmoplegia N/A N/A GenCC
Hereditary spastic paraplegia Hereditary spastic paraplegia N/A N/A ClinVar
Mitochondrial DNA Deletion Syndrome mitochondrial DNA depletion syndrome 7 (hepatocerebral type) N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholic Neuropathy Associate 24816431
Ataxia Associate 31852434, 37932750
Atrophy Associate 28178980
Auditory neuropathy Associate 39340975
Brain Stem Neoplasms Associate 37316776
Carcinoma Ovarian Epithelial Associate 22233925
Cerebellar Ataxia Associate 32234020
Deafness Associate 32234020, 33095980
Depressive Disorder Associate 31852434
Disease Associate 25355836