Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56649
Gene name Gene Name - the full gene name approved by the HGNC.	Transmembrane serine protease 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TMPRSS4
Synonyms (NCBI Gene) Gene synonyms aliases	CAP2, CAPH2, MT-SP2, TMPRSS3
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pa

Show/Hide all(74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT716037	hsa-miR-543	HITS-CLIP	19536157
MIRT716036	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT716035	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT716034	hsa-miR-875-3p	HITS-CLIP	19536157
MIRT716033	hsa-miR-6128	HITS-CLIP	19536157
MIRT716032	hsa-miR-1299	HITS-CLIP	19536157
MIRT716031	hsa-miR-516b-5p	HITS-CLIP	19536157
MIRT716030	hsa-miR-4782-5p	HITS-CLIP	19536157
MIRT716029	hsa-miR-5706	HITS-CLIP	19536157
MIRT444211	hsa-miR-3529-3p	PAR-CLIP	22100165
MIRT444210	hsa-miR-4635	PAR-CLIP	22100165
MIRT444209	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT444208	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT444207	hsa-miR-1262	PAR-CLIP	22100165
MIRT444206	hsa-miR-4701-3p	PAR-CLIP	22100165
MIRT444205	hsa-miR-6736-5p	PAR-CLIP	22100165
MIRT716037	hsa-miR-543	HITS-CLIP	19536157
MIRT716036	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT716035	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT716034	hsa-miR-875-3p	HITS-CLIP	19536157
MIRT716033	hsa-miR-6128	HITS-CLIP	19536157
MIRT716032	hsa-miR-1299	HITS-CLIP	19536157
MIRT716031	hsa-miR-516b-5p	HITS-CLIP	19536157
MIRT716030	hsa-miR-4782-5p	HITS-CLIP	19536157
MIRT716029	hsa-miR-5706	HITS-CLIP	19536157
MIRT444211	hsa-miR-3529-3p	PAR-CLIP	22100165
MIRT444210	hsa-miR-4635	PAR-CLIP	22100165
MIRT444209	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT444208	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT444207	hsa-miR-1262	PAR-CLIP	22100165
MIRT444206	hsa-miR-4701-3p	PAR-CLIP	22100165
MIRT444205	hsa-miR-6736-5p	PAR-CLIP	22100165
MIRT1441136	hsa-miR-188-5p	CLIP-seq
MIRT1441137	hsa-miR-1909	CLIP-seq
MIRT1441138	hsa-miR-2054	CLIP-seq
MIRT1441139	hsa-miR-2110	CLIP-seq
MIRT1441140	hsa-miR-28-5p	CLIP-seq
MIRT1441141	hsa-miR-3124-3p	CLIP-seq
MIRT1441142	hsa-miR-3139	CLIP-seq
MIRT1441143	hsa-miR-3150a-3p	CLIP-seq
MIRT1441144	hsa-miR-3180-5p	CLIP-seq
MIRT1441145	hsa-miR-325	CLIP-seq
MIRT1441146	hsa-miR-338-3p	CLIP-seq
MIRT1441147	hsa-miR-3977	CLIP-seq
MIRT1441148	hsa-miR-4310	CLIP-seq
MIRT1441149	hsa-miR-4450	CLIP-seq
MIRT1441150	hsa-miR-4658	CLIP-seq
MIRT1441151	hsa-miR-4691-3p	CLIP-seq
MIRT1441152	hsa-miR-4709-5p	CLIP-seq
MIRT1441153	hsa-miR-4758-5p	CLIP-seq
MIRT1441154	hsa-miR-549	CLIP-seq
MIRT1441155	hsa-miR-578	CLIP-seq
MIRT1441156	hsa-miR-628-3p	CLIP-seq
MIRT1441157	hsa-miR-634	CLIP-seq
MIRT1441158	hsa-miR-664	CLIP-seq
MIRT1441159	hsa-miR-708	CLIP-seq
MIRT1441160	hsa-miR-935	CLIP-seq
MIRT2132084	hsa-miR-186	CLIP-seq
MIRT2353179	hsa-miR-1207-5p	CLIP-seq
MIRT2353180	hsa-miR-1304	CLIP-seq
MIRT2132084	hsa-miR-186	CLIP-seq
MIRT2353181	hsa-miR-3187-3p	CLIP-seq
MIRT2353182	hsa-miR-331-3p	CLIP-seq
MIRT2353183	hsa-miR-3679-3p	CLIP-seq
MIRT2353184	hsa-miR-4287	CLIP-seq
MIRT2353185	hsa-miR-4529-5p	CLIP-seq
MIRT2353186	hsa-miR-4685-3p	CLIP-seq
MIRT2353187	hsa-miR-4763-3p	CLIP-seq
MIRT2353188	hsa-miR-378g	CLIP-seq
MIRT2693585	hsa-miR-1305	CLIP-seq
MIRT2693586	hsa-miR-3921	CLIP-seq
MIRT2693587	hsa-miR-4653-5p	CLIP-seq
MIRT2693588	hsa-miR-593	CLIP-seq
MIRT2693589	hsa-miR-95	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	NAS	10825129
GO:0005044	Function	Scavenger receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005615	Component	Extracellular space	IDA	24434139
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	24434139
GO:0006508	Process	Proteolysis	NAS	10825129
GO:0006897	Process	Endocytosis	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	24434139
GO:0009611	Process	Response to wounding	IEA
GO:0010468	Process	Regulation of gene expression	IDA	29529050
GO:0016021	Component	Integral component of membrane	NAS	10825129
GO:0016485	Process	Protein processing	IDA	24434139
GO:0030141	Component	Secretory granule	IDA	29529050
GO:0045967	Process	Negative regulation of growth rate	IDA	29529050
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	32404436

MIM	HGNC	e!Ensembl
606565	11878	ENSG00000137648

Protein

UniProt ID

Q9NRS4

Protein name

Transmembrane protease serine 4 (EC 3.4.21.-) (Channel-activating protease 2) (CAPH2) (Membrane-type serine protease 2) (MT-SP2) [Cleaved into: Transmembrane protease serine 4 catalytic chain]

Protein function

Plasma membrane-anchored serine protease that directly induces processing of pro-uPA/PLAU into the active form through proteolytic activity (PubMed:24434139). Seems to be capable of activating ENaC (By similarity). {ECO:0000250|UniProtKB:Q8VCA5,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15494	SRCR_2	108 → 200	Scavenger receptor cysteine-rich domain	Domain
PF00089	Trypsin	205 → 429	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: High levels in pancreatic, gastric, colorectal and ampullary cancer. Very weak expression in normal gastrointestinal and urogenital tract (PubMed:10825129). Coexpressed with ACE2 within mature enterocytes (PubMed:32404436). {ECO:000026

Sequence

MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKY
YFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT
GNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSS
GPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWV
LTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPL
TFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADD
AYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT
KVSAYLNWIYNVWKAEL

Sequence length

437

Interactions

View interactions

	KEGG
	Influenza A

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Cerebral Atrophy	autosomal recessive cerebral atrophy			GenCC

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Stimulate	29750426, 33649798
Asthma	Associate	34198852
Atrophy	Associate	23957953
Autistic Disorder	Associate	39766876
Breast Neoplasms	Stimulate	28259959
Breast Neoplasms	Associate	31244309, 31870109
Carcinoma Bronchogenic	Associate	35211765
Carcinoma Hepatocellular	Associate	31858539
Carcinoma Non Small Cell Lung	Associate	25414083
Carcinoma Pancreatic Ductal	Associate	15548371, 40379788
Carcinoma Squamous Cell	Associate	26989022
Carcinoma Squamous Cell	Stimulate	33649798
Carcinosarcoma	Associate	33649798
Colonic Neoplasms	Associate	33649798
Colorectal Neoplasms	Associate	24335200, 34595980
COVID 19	Associate	33649798, 34198852, 34252054, 35211765, 35261286
Endometrial Neoplasms	Stimulate	33649798
Gallbladder Neoplasms	Associate	24532432
Gastrointestinal Neoplasms	Associate	35970857
Kidney Neoplasms	Inhibit	33649798
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	35283406
Liver Failure	Stimulate	34595980
Lung Neoplasms	Associate	24434435
Lung Neoplasms	Stimulate	25414083
Lymphatic Metastasis	Associate	23857060, 23922976, 36380313, 40379788
Lymphatic Metastasis	Stimulate	24532432, 28259959, 34595980
Melanoma Cutaneous Malignant	Inhibit	33649798
Myelodysplastic Syndromes	Associate	35283406
Neoplasm Metastasis	Associate	23922976, 24434435, 31858539, 34595980, 36380313
Neoplasms	Associate	16135921, 16688775, 23857060, 23922976, 24335200, 24434435, 24532432, 24553122, 25550850, 26989022, 28259959, 28466252, 31244309, 32154571, 34379296 View all (4 more)
Neoplasms	Stimulate	25244400, 33649798, 34595980, 35211765
Neoplasms Germ Cell and Embryonal	Inhibit	33649798
Neoplasms Squamous Cell	Associate	26989022
Neurodegenerative Diseases	Associate	23957953
Neurologic Manifestations	Associate	35868344
Ovarian Neoplasms	Stimulate	33649798
Pancreatic Neoplasms	Associate	22985314, 30639415, 32235821, 33815409
Pancreatic Neoplasms	Stimulate	33649798
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	33649798
Prostatic Neoplasms	Associate	25550850, 28466252
Pulmonary Disease Chronic Obstructive	Associate	35211765
Rectal Neoplasms	Associate	33649798
Stomach Neoplasms	Associate	23922976, 34379296
Tertiary Lymphoid Structures	Stimulate	23922976
Tertiary Lymphoid Structures	Associate	34595980
Thyroid Cancer Papillary	Associate	32154571
Thyroid Neoplasms	Associate	16135921, 36380313
Thyroid Neoplasms	Stimulate	25244400, 33649798
Triple Negative Breast Neoplasms	Stimulate	23857060
Triple Negative Breast Neoplasms	Associate	31870109
Urinary Bladder Neoplasms	Associate	39368544
Virus Diseases	Associate	33649798, 35261286

TMPRSS4 (transmembrane serine protease 4)