TMPRSS4 (transmembrane serine protease 4)

Gene

• Entrez ID: 56649
• Gene name: Transmembrane serine protease 4
• Gene symbol: TMPRSS4
• Synonyms (NCBI Gene): CAP2, CAPH2, MT-SP2, TMPRSS3
• Chromosome: 11
• Chromosome location: 11q23.3
• Summary: This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT716037	hsa-miR-543	HITS-CLIP	19536157
MIRT716036	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT716035	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT716034	hsa-miR-875-3p	HITS-CLIP	19536157
MIRT716033	hsa-miR-6128	HITS-CLIP	19536157
MIRT716032	hsa-miR-1299	HITS-CLIP	19536157
MIRT716031	hsa-miR-516b-5p	HITS-CLIP	19536157
MIRT716030	hsa-miR-4782-5p	HITS-CLIP	19536157
MIRT716029	hsa-miR-5706	HITS-CLIP	19536157
MIRT444211	hsa-miR-3529-3p	PAR-CLIP	22100165
MIRT444210	hsa-miR-4635	PAR-CLIP	22100165
MIRT444209	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT444208	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT444207	hsa-miR-1262	PAR-CLIP	22100165
MIRT444206	hsa-miR-4701-3p	PAR-CLIP	22100165
MIRT444205	hsa-miR-6736-5p	PAR-CLIP	22100165
MIRT716037	hsa-miR-543	HITS-CLIP	19536157
MIRT716036	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT716035	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT716034	hsa-miR-875-3p	HITS-CLIP	19536157
MIRT716033	hsa-miR-6128	HITS-CLIP	19536157
MIRT716032	hsa-miR-1299	HITS-CLIP	19536157
MIRT716031	hsa-miR-516b-5p	HITS-CLIP	19536157
MIRT716030	hsa-miR-4782-5p	HITS-CLIP	19536157
MIRT716029	hsa-miR-5706	HITS-CLIP	19536157
MIRT444211	hsa-miR-3529-3p	PAR-CLIP	22100165
MIRT444210	hsa-miR-4635	PAR-CLIP	22100165
MIRT444209	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT444208	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT444207	hsa-miR-1262	PAR-CLIP	22100165
MIRT444206	hsa-miR-4701-3p	PAR-CLIP	22100165
MIRT444205	hsa-miR-6736-5p	PAR-CLIP	22100165
MIRT1441136	hsa-miR-188-5p	CLIP-seq
MIRT1441137	hsa-miR-1909	CLIP-seq
MIRT1441138	hsa-miR-2054	CLIP-seq
MIRT1441139	hsa-miR-2110	CLIP-seq
MIRT1441140	hsa-miR-28-5p	CLIP-seq
MIRT1441141	hsa-miR-3124-3p	CLIP-seq
MIRT1441142	hsa-miR-3139	CLIP-seq
MIRT1441143	hsa-miR-3150a-3p	CLIP-seq
MIRT1441144	hsa-miR-3180-5p	CLIP-seq
MIRT1441145	hsa-miR-325	CLIP-seq
MIRT1441146	hsa-miR-338-3p	CLIP-seq
MIRT1441147	hsa-miR-3977	CLIP-seq
MIRT1441148	hsa-miR-4310	CLIP-seq
MIRT1441149	hsa-miR-4450	CLIP-seq
MIRT1441150	hsa-miR-4658	CLIP-seq
MIRT1441151	hsa-miR-4691-3p	CLIP-seq
MIRT1441152	hsa-miR-4709-5p	CLIP-seq
MIRT1441153	hsa-miR-4758-5p	CLIP-seq
MIRT1441154	hsa-miR-549	CLIP-seq
MIRT1441155	hsa-miR-578	CLIP-seq
MIRT1441156	hsa-miR-628-3p	CLIP-seq
MIRT1441157	hsa-miR-634	CLIP-seq
MIRT1441158	hsa-miR-664	CLIP-seq
MIRT1441159	hsa-miR-708	CLIP-seq
MIRT1441160	hsa-miR-935	CLIP-seq
MIRT2132084	hsa-miR-186	CLIP-seq
MIRT2353179	hsa-miR-1207-5p	CLIP-seq
MIRT2353180	hsa-miR-1304	CLIP-seq
MIRT2132084	hsa-miR-186	CLIP-seq
MIRT2353181	hsa-miR-3187-3p	CLIP-seq
MIRT2353182	hsa-miR-331-3p	CLIP-seq
MIRT2353183	hsa-miR-3679-3p	CLIP-seq
MIRT2353184	hsa-miR-4287	CLIP-seq
MIRT2353185	hsa-miR-4529-5p	CLIP-seq
MIRT2353186	hsa-miR-4685-3p	CLIP-seq
MIRT2353187	hsa-miR-4763-3p	CLIP-seq
MIRT2353188	hsa-miR-378g	CLIP-seq
MIRT2693585	hsa-miR-1305	CLIP-seq
MIRT2693586	hsa-miR-3921	CLIP-seq
MIRT2693587	hsa-miR-4653-5p	CLIP-seq
MIRT2693588	hsa-miR-593	CLIP-seq
MIRT2693589	hsa-miR-95	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	10825129
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	24434139
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	24434139
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	NAS	10825129
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IDA	24434139
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0010468	Process	Regulation of gene expression	IDA	29529050
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10825129
GO:0016485	Process	Protein processing	IBA
GO:0016485	Process	Protein processing	IDA	24434139
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IDA	29529050
GO:0030141	Component	Secretory granule	IEA
GO:0045967	Process	Negative regulation of growth rate	IDA	29529050
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	32404436

Other IDs

• MIM: 606565
• HGNC: 11878
• e!Ensembl: ENSG00000137648

Protein

• UniProt ID: Q9NRS4
• Protein name: Transmembrane protease serine 4 (EC 3.4.21.-) (Channel-activating protease 2) (CAPH2) (Membrane-type serine protease 2) (MT-SP2) [Cleaved into: Transmembrane protease serine 4 catalytic chain]
• Protein function: Plasma membrane-anchored serine protease that directly induces processing of pro-uPA/PLAU into the active form through proteolytic activity (PubMed:24434139). Seems to be capable of activating ENaC (By similarity). {ECO:0000250|UniProtKB:Q8VCA5,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15494	SRCR_2	108 → 200	Scavenger receptor cysteine-rich domain	Domain
  PF00089	Trypsin	205 → 429	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: High levels in pancreatic, gastric, colorectal and ampullary cancer. Very weak expression in normal gastrointestinal and urogenital tract (PubMed:10825129). Coexpressed with ACE2 within mature enterocytes (PubMed:32404436). {ECO:000026
• Sequence:

  MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKY
  YFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT
  GNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSS
  GPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWV
  LTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPL
  TFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADD
  AYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT
  KVSAYLNWIYNVWKAEL

• Sequence length: 437

Pathways

KEGG:

Influenza A

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOSOMAL RECESSIVE CEREBRAL ATROPHY	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Stimulate	29750426, 33649798	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	34198852	★☆☆☆☆ Found in Text Mining only
Atrophy	Associate	23957953	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Associate	39766876	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	28259959	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	31244309, 31870109	★☆☆☆☆ Found in Text Mining only
Carcinoma Bronchogenic	Associate	35211765	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	31858539	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	25414083	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	15548371, 40379788	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	26989022	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Stimulate	33649798	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Associate	33649798	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	33649798	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24335200, 34595980	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	33649798, 34198852, 34252054, 35211765, 35261286	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Stimulate	33649798	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	24532432	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Associate	35970857	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Inhibit	33649798	★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	35283406	★☆☆☆☆ Found in Text Mining only
Liver Failure	Stimulate	34595980	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	24434435	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	25414083	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	23857060, 23922976, 36380313, 40379788	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	24532432, 28259959, 34595980	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Inhibit	33649798	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	35283406	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	23922976, 24434435, 31858539, 34595980, 36380313	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16135921, 16688775, 23857060, 23922976, 24335200, 24434435, 24532432, 24553122, 25550850, 26989022, 28259959, 28466252, 31244309, 32154571, 34379296, 35970857, 36380313, 37965307, 40379788	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	25244400, 33649798, 34595980, 35211765	★☆☆☆☆ Found in Text Mining only
Neoplasms Germ Cell and Embryonal	Inhibit	33649798	★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	26989022	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	23957953	★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	35868344	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Stimulate	33649798	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	22985314, 30639415, 32235821, 33815409	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Stimulate	33649798	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	33649798	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	25550850, 28466252	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	35211765	★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	33649798	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	23922976, 34379296	★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Stimulate	23922976	★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	34595980	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	32154571	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	16135921, 36380313	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Stimulate	25244400, 33649798	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Stimulate	23857060	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	31870109	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	39368544	★☆☆☆☆ Found in Text Mining only
Virus Diseases	Associate	33649798, 35261286	★☆☆☆☆ Found in Text Mining only