Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56477
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine ligand 28
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCL28
Synonyms (NCBI Gene) Gene synonyms aliases	CCK1, MEC, SCYA28
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p12
Summary Summary of gene provided in NCBI Entrez Gene.	This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cy

Show/Hide all(60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019466	hsa-miR-148b-3p	Microarray	17612493
MIRT871041	hsa-miR-1245	CLIP-seq
MIRT871042	hsa-miR-129-5p	CLIP-seq
MIRT871043	hsa-miR-1912	CLIP-seq
MIRT871044	hsa-miR-3130-5p	CLIP-seq
MIRT871045	hsa-miR-3663-5p	CLIP-seq
MIRT871046	hsa-miR-371-5p	CLIP-seq
MIRT871047	hsa-miR-371b-5p	CLIP-seq
MIRT871048	hsa-miR-4482	CLIP-seq
MIRT871049	hsa-miR-4676-5p	CLIP-seq
MIRT871050	hsa-miR-513c	CLIP-seq
MIRT871051	hsa-miR-514b-5p	CLIP-seq
MIRT871052	hsa-miR-575	CLIP-seq
MIRT871041	hsa-miR-1245	CLIP-seq
MIRT1958629	hsa-miR-1976	CLIP-seq
MIRT1958630	hsa-miR-302a	CLIP-seq
MIRT1958631	hsa-miR-302b	CLIP-seq
MIRT1958632	hsa-miR-302c	CLIP-seq
MIRT1958633	hsa-miR-302d	CLIP-seq
MIRT1958634	hsa-miR-302e	CLIP-seq
MIRT871045	hsa-miR-3663-5p	CLIP-seq
MIRT871046	hsa-miR-371-5p	CLIP-seq
MIRT871047	hsa-miR-371b-5p	CLIP-seq
MIRT1958635	hsa-miR-372	CLIP-seq
MIRT1958636	hsa-miR-373	CLIP-seq
MIRT1958637	hsa-miR-431	CLIP-seq
MIRT1958638	hsa-miR-4423-5p	CLIP-seq
MIRT1958639	hsa-miR-4722-3p	CLIP-seq
MIRT1958640	hsa-miR-4731-5p	CLIP-seq
MIRT1958641	hsa-miR-4781-3p	CLIP-seq
MIRT1958642	hsa-miR-512-3p	CLIP-seq
MIRT871050	hsa-miR-513c	CLIP-seq
MIRT871051	hsa-miR-514b-5p	CLIP-seq
MIRT1958643	hsa-miR-520a-3p	CLIP-seq
MIRT1958644	hsa-miR-520b	CLIP-seq
MIRT1958645	hsa-miR-520c-3p	CLIP-seq
MIRT1958646	hsa-miR-520d-3p	CLIP-seq
MIRT1958647	hsa-miR-520e	CLIP-seq
MIRT1958648	hsa-miR-579	CLIP-seq
MIRT871041	hsa-miR-1245	CLIP-seq
MIRT1958629	hsa-miR-1976	CLIP-seq
MIRT1958630	hsa-miR-302a	CLIP-seq
MIRT1958631	hsa-miR-302b	CLIP-seq
MIRT1958632	hsa-miR-302c	CLIP-seq
MIRT1958633	hsa-miR-302d	CLIP-seq
MIRT1958634	hsa-miR-302e	CLIP-seq
MIRT1958635	hsa-miR-372	CLIP-seq
MIRT1958636	hsa-miR-373	CLIP-seq
MIRT1958639	hsa-miR-4722-3p	CLIP-seq
MIRT1958643	hsa-miR-520a-3p	CLIP-seq
MIRT1958644	hsa-miR-520b	CLIP-seq
MIRT1958645	hsa-miR-520c-3p	CLIP-seq
MIRT1958646	hsa-miR-520d-3p	CLIP-seq
MIRT1958647	hsa-miR-520e	CLIP-seq
MIRT871045	hsa-miR-3663-5p	CLIP-seq
MIRT871046	hsa-miR-371-5p	CLIP-seq
MIRT871047	hsa-miR-371b-5p	CLIP-seq
MIRT1958637	hsa-miR-431	CLIP-seq
MIRT1958638	hsa-miR-4423-5p	CLIP-seq
MIRT1958641	hsa-miR-4781-3p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IBA	21873635
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IDA	18308860
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 28381538, 31515488, 32296183
GO:0005576	Component	Extracellular region	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0006935	Process	Chemotaxis	TAS	10781587
GO:0006955	Process	Immune response	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	18308860
GO:0008009	Function	Chemokine activity	TAS	10781587
GO:0060326	Process	Cell chemotaxis	IBA	21873635
GO:0060326	Process	Cell chemotaxis	IDA	18308860
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:1903237	Process	Negative regulation of leukocyte tethering or rolling	IDA	18308860

MIM	HGNC	e!Ensembl
605240	17700	ENSG00000151882

Protein

UniProt ID

Q9NRJ3

Protein name

C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28)

Protein function

Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.

PDB

6CWS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	28 → 87	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in

Sequence

MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY

Sequence length

127

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Intestinal immune network for IgA production		Chemokine receptors bind chemokines G alpha (i) signalling events

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	References	Source
Unknown
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease		26634245	ClinVar
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA
Alzheimer disease	Alzheimer disease			GWAS

Show/Hide Text Mining Associations (33)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	35494513, 37790851
Arthritis Rheumatoid	Associate	24833787, 30619268
Arthritis Rheumatoid	Inhibit	35048789
Asthma	Associate	38128411
Attention Deficit Disorder with Hyperactivity	Associate	39566744
Carcinogenesis	Associate	38081950
Colitis Ulcerative	Stimulate	32102131
Colorectal Neoplasms	Associate	32564470, 33868236, 36890467
Dental Caries	Inhibit	35048789
Dry Eye Syndromes	Associate	38453037
Endometriosis	Stimulate	34913072
Esophageal Neoplasms	Associate	28385379
Fetal Growth Retardation	Associate	27330572
Gallbladder Neoplasms	Associate	36871090
Gastritis	Associate	18426876
Gastrointestinal Diseases	Associate	18426876
Hereditary leiomyomatosis and renal cell cancer	Associate	14982853
HIV Infections	Associate	32346082
Hodgkin Disease	Associate	14982853
Hypoxia	Associate	33658305
Idiopathic Pulmonary Fibrosis	Stimulate	34689792
Inflammation	Associate	16785557
Joint Diseases	Associate	24833787
Lupus Erythematosus Systemic	Inhibit	35048789
Neoplasm Metastasis	Associate	35494513
Neoplasms	Associate	25740824, 36082430
Pain	Associate	35531763
Prostatic Neoplasms	Associate	38087324
Pulmonary Disease Chronic Obstructive	Associate	21883889
Sjogren's Syndrome	Inhibit	35048789
Small Cell Lung Carcinoma	Stimulate	39516747
Stomach Neoplasms	Associate	38081950
Thrombocytopenia	Inhibit	35048789

CCL28 (C-C motif chemokine ligand 28)