Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5646
Gene name	Serine protease 3
Gene symbol	PRSS3
Synonyms (NCBI Gene)	MTGPRSS4T9TRY3TRY4
Chromosome	9
Chromosome location	9p13.3
Summary	This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group o

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	6698368, 11827488, 14507909, 25301953
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	6698368, 11827488
GO:0005515	Function	Protein binding	IPI	6698368, 14507909
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	6698368
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	6698368, 11827488
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	NAS	8294000
GO:0006508	Process	Proteolysis	TAS	2326201
GO:0007586	Process	Digestion	IEA
GO:0007586	Process	Digestion	TAS	2326201, 6698368, 14507909
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	9099703
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0031638	Process	Zymogen activation	IDA	6698368
GO:0043542	Process	Endothelial cell migration	IMP	15313892
GO:0046872	Function	Metal ion binding	IEA
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
613578	9486	ENSG00000010438

P35030

Protein name

Trypsin-3 (EC 3.4.21.4) (Brain trypsinogen) (Mesotrypsin) (Mesotrypsinogen) (Serine protease 3) (Serine protease 4) (Trypsin III) (Trypsin IV)

Protein function

Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors. {ECO:0000269|PubMed:11827488, ECO:0000269|PubMed:14507909, ECO:0000269|PubMed:18077447, ECO:0000269|

PDB

1H4W , 2R9P , 3L33 , 3L3T , 3P92 , 3P95 , 4DG4 , 4U30 , 4U32 , 5C67 , 5JBT , 5TP0 , 6BX8 , 6GFI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	81 → 296	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in pancreas and pancreatic fluid (at protein level) (PubMed:6698368). Expressed in pancreas and brain (PubMed:8294000). Detected in ileum (PubMed:12021776). {ECO:0000269|PubMed:12021776, ECO:0000269|PubMed:6698368, ECO:0000269

Sequence

MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAAR
DADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
CYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARV
STISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSM
FCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTI
AANS

Sequence length

304

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Pancreatic secretion Protein digestion and absorption Influenza A		Alpha-defensins Cobalamin (Cbl, vitamin B12) transport and metabolism Neutrophil degranulation Antimicrobial peptides

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroiditis	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	24146905	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	30755669, 34323652	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	40033250	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Inhibit	14507909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Axial osteomalacia	Associate	34602499	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Stimulate	24146905	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	20035377	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Stimulate	28423522	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	28844099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	36056349	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	26662304	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Endothelial Cell Loss	Associate	18447899	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Inhibit	24743736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	34195683	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	18179710	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	37395651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	26662304	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	36618965	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large Cell Anaplastic	Associate	18179710	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	21203532	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	28844099, 36056349, 37395651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	18447899, 26318044, 26957636, 28423522, 28844099, 30755669	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	23251453	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	35038288	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	36906533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Associate	14507909, 32014997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Associate	20484962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	26957636, 32800727	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Inhibit	24743736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	21203532	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

PRSS3 (serine protease 3)