Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5646
Gene name Gene Name - the full gene name approved by the HGNC.	Serine protease 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRSS3
Synonyms (NCBI Gene) Gene synonyms aliases	MTG, PRSS4, T9, TRY3, TRY4
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group o

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0004252	Function	Serine-type endopeptidase activity	IDA	6698368, 11827488, 14507909
GO:0005509	Function	Calcium ion binding	IDA	6698368, 11827488
GO:0005515	Function	Protein binding	IPI	6698368, 14507909
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	6698368
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0006508	Process	Proteolysis	IDA	6698368, 11827488
GO:0006508	Process	Proteolysis	NAS	8294000
GO:0007586	Process	Digestion	TAS	6698368, 14507909
GO:0009235	Process	Cobalamin metabolic process	TAS
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0031638	Process	Zymogen activation	IDA	6698368
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043542	Process	Endothelial cell migration	IMP	15313892
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
613578	9486	ENSG00000010438

Protein

UniProt ID

P35030

Protein name

Trypsin-3 (EC 3.4.21.4) (Brain trypsinogen) (Mesotrypsin) (Mesotrypsinogen) (Serine protease 3) (Serine protease 4) (Trypsin III) (Trypsin IV)

Protein function

Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors. {ECO:0000269|PubMed:11827488, ECO:0000269|PubMed:14507909, ECO:0000269|PubMed:18077447, ECO:0000269|

PDB

1H4W , 2R9P , 3L33 , 3L3T , 3P92 , 3P95 , 4DG4 , 4U30 , 4U32 , 5C67 , 5JBT , 5TP0 , 6BX8 , 6GFI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	81 → 296	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in pancreas and pancreatic fluid (at protein level) (PubMed:6698368). Expressed in pancreas and brain (PubMed:8294000). Detected in ileum (PubMed:12021776). {ECO:0000269|PubMed:12021776, ECO:0000269|PubMed:6698368, ECO:0000269

Sequence

MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAAR
DADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
CYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARV
STISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSM
FCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTI
AANS

Sequence length

304

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Pancreatic secretion Protein digestion and absorption Influenza A		Alpha-defensins Cobalamin (Cbl, vitamin B12) transport and metabolism Neutrophil degranulation Antimicrobial peptides

PRSS3 (serine protease 3)