PRSS2 (serine protease 2)

Gene

• Entrez ID: 5645
• Gene name: Serine protease 2
• Gene symbol: PRSS2
• Synonyms (NCBI Gene): TRY2, TRY8, TRYP2
• Chromosome: 7
• Chromosome location: 7q34
• Summary: This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysin

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0004252	Function	Serine-type endopeptidase activity	IDA	12709065, 12731883
GO:0005509	Function	Calcium ion binding	IDA	12709065
GO:0005515	Function	Protein binding	IPI	16192646
GO:0005576	Component	Extracellular region	IDA	12731883
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IMP	16192646
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0006508	Process	Proteolysis	IDA	12731883
GO:0007586	Process	Digestion	IEA
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030307	Process	Positive regulation of cell growth	TAS	12731883
GO:0030574	Process	Collagen catabolic process	IDA	12731883
GO:0030574	Process	Collagen catabolic process	IMP	16192646
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	TAS	12731883
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045785	Process	Positive regulation of cell adhesion	TAS	12731883

Other IDs

• MIM: 601564
• HGNC: 9483
• e!Ensembl: ENSG00000275896

Protein

• UniProt ID: P07478
• Protein name: Trypsin-2 (EC 3.4.21.4) (Anionic trypsinogen) (Serine protease 2) (Trypsin II)
• Protein function: In the ileum, may be involved in defensin processing, including DEFA5.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	24 → 239	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in Paneth cells, at the base of small intestinal crypts. {ECO:0000269|PubMed:12021776}.
• Sequence:

  MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
  AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
  SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
  NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
  DTIAANS

• Sequence length: 247

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A

Reactome:

Collagen degradation
Alpha-defensins
Activation of Matrix Metalloproteinases
Neutrophil degranulation
Antimicrobial peptides

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261
Hereditary pancreatitis	Hereditary pancreatitis, Hereditary chronic pancreatitis	rs113993960, rs113993959, rs75527207, rs80034486, rs121909294, rs111033565, rs111033566, rs111033567, rs267606982, rs111033568, rs104893938, rs104893939, rs387906698, rs193922659, rs397507439, rs202003805, rs121908774, rs397508198, rs397508387, rs121909034, rs397508706, rs374705585, rs148954387, rs515726210, rs199769221, rs1805177, rs797045159, rs3034796, rs1060503164, rs1554382608, rs121909005, rs369503365, rs1554089895, rs1557508272, rs747905422, rs1562898489, rs1561606446, rs766917452, rs1570784592	18461367, 16699518

Unknown
Disease term	Disease name	Evidence	References	Source
Pancreatitis	Pancreatitis, Pancreatitis, Chronic, Autosomal Dominant Hereditary Pancreatitis, Recurrent pancreatitis		16699518, 18206817	ClinVar
Oligodendroglioma	Oligodendroglioma			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Anemia Aplastic	Associate	35435273
Carcinogenesis	Associate	37022096
Cerebral Palsy Ataxic Autosomal Recessive	Associate	19096130
Colorectal Neoplasms	Associate	29193645
Cystic Fibrosis	Associate	36386424
Dyskinesia Drug Induced	Associate	25982926
Hodgkin Disease	Associate	18179710
Lewy Body Disease	Associate	25982926
Lymphoma Large Cell Anaplastic	Associate	18179710
Meconium Ileus	Associate	36386424
Neoplasm Metastasis	Associate	37022096
Neoplasms	Associate	36575174
Ovarian Cysts	Associate	12743421
Ovarian Neoplasms	Associate	11355948
Pancreatitis	Associate	23143602, 30467200, 36386424
Pancreatitis Chronic	Associate	15776435, 16699518, 26820620, 28754779, 37389024
Parkinson Disease	Associate	25982926
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30467200
Progressive hearing loss stapes fixation	Associate	23143602
Psychotic Disorders	Associate	25982926
Stomach Neoplasms	Associate	37022096