Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5645
Gene name	Serine protease 2
Gene symbol	PRSS2
Synonyms (NCBI Gene)	TRY2TRY8TRYP2
Chromosome	7
Chromosome location	7q34
Summary	This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysin

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	12709065, 12731883
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005509	Function	Calcium ion binding	IDA	12709065
GO:0005515	Function	Protein binding	IPI	16192646
GO:0005576	Component	Extracellular region	IDA	12731883
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IMP	16192646
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	12731883
GO:0006508	Process	Proteolysis	IEA
GO:0007586	Process	Digestion	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030307	Process	Positive regulation of cell growth	TAS	12731883
GO:0030574	Process	Collagen catabolic process	IDA	12731883
GO:0030574	Process	Collagen catabolic process	IMP	16192646
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	TAS	12731883
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0045785	Process	Positive regulation of cell adhesion	TAS	12731883
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
601564	9483	ENSG00000275896

P07478

Protein name

Trypsin-2 (EC 3.4.21.4) (Anionic trypsinogen) (Serine protease 2) (Trypsin II)

Protein function

In the ileum, may be involved in defensin processing, including DEFA5.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	24 → 239	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in Paneth cells, at the base of small intestinal crypts. {ECO:0000269|PubMed:12021776}.

Sequence

MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS

Sequence length

247

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Pancreatic secretion Protein digestion and absorption Influenza A		Collagen degradation Alpha-defensins Activation of Matrix Metalloproteinases Neutrophil degranulation Antimicrobial peptides

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Pancreatitis, chronic, protection against	protective	rs61734659	RCV000008536

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anemia Aplastic	Associate	35435273
Carcinogenesis	Associate	37022096
Cerebral Palsy Ataxic Autosomal Recessive	Associate	19096130
Colorectal Neoplasms	Associate	29193645
Cystic Fibrosis	Associate	36386424
Dyskinesia Drug Induced	Associate	25982926
Hodgkin Disease	Associate	18179710
Lewy Body Disease	Associate	25982926
Lymphoma Large Cell Anaplastic	Associate	18179710
Meconium Ileus	Associate	36386424
Neoplasm Metastasis	Associate	37022096
Neoplasms	Associate	36575174
Ovarian Cysts	Associate	12743421
Ovarian Neoplasms	Associate	11355948
Pancreatitis	Associate	23143602, 30467200, 36386424
Pancreatitis Chronic	Associate	15776435, 16699518, 26820620, 28754779, 37389024
Parkinson Disease	Associate	25982926
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30467200
Progressive hearing loss stapes fixation	Associate	23143602
Psychotic Disorders	Associate	25982926
Stomach Neoplasms	Associate	37022096

PRSS2 (serine protease 2)