SLC7A10 (solute carrier family 7 member 10)

Gene

• Entrez ID: 56301
• Gene name: Solute carrier family 7 member 10
• Gene symbol: SLC7A10
• Synonyms (NCBI Gene): ASC1, HASC-1, asc-1
• Chromosome: 19
• Chromosome location: 19q13.11
• Summary: SLC7A10, in association with 4F2HC (SLC3A2; MIM 158070), mediates high-affinity transport of D-serine and several other neutral amino acids (Nakauchi et al., 2000 [PubMed 10863037]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1366731	hsa-miR-1245b-5p	CLIP-seq
MIRT1366732	hsa-miR-3142	CLIP-seq
MIRT1366733	hsa-miR-621	CLIP-seq
MIRT1366734	hsa-miR-873	CLIP-seq
MIRT2108798	hsa-miR-4436b-3p	CLIP-seq
MIRT2108799	hsa-miR-4690-5p	CLIP-seq
MIRT1366733	hsa-miR-621	CLIP-seq
MIRT1366734	hsa-miR-873	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10863037
GO:0005886	Component	Plasma membrane	TAS	10734121
GO:0006865	Process	Amino acid transport	IEA
GO:0006865	Process	Amino acid transport	TAS	10734121
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IDA	10863037
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IBA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IEA
GO:0015194	Function	L-serine transmembrane transporter activity	TAS	10863037
GO:0015804	Process	Neutral amino acid transport	IDA	10863037
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015816	Process	Glycine transport	IEA
GO:0015825	Process	L-serine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10734121
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042941	Process	D-alanine transmembrane transport	IBA
GO:0042941	Process	D-alanine transmembrane transport	IEA
GO:0042942	Process	D-serine transmembrane transport	IBA
GO:0042942	Process	D-serine transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060094	Process	Positive regulation of synaptic transmission, glycinergic	IEA
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IEA
GO:1903444	Process	Negative regulation of brown fat cell differentiation	IEA

Other IDs

• MIM: 607959
• HGNC: 11058
• e!Ensembl: ENSG00000130876

Protein

• UniProt ID: Q9NS82
• Protein name: Asc-type amino acid transporter 1 (Asc-1) (Solute carrier family 7 member 10)
• Protein function: Associates with SLC3A2/4F2hc to form a functional heterodimeric complex that translocates small neutral L- and D-amino acids across the plasma membrane. Preferentially mediates exchange transport, but can also operate via facilitated diffusion (
• PDB: 8QEY, 8WNS, 8WNT, 8WNY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13520	AA_permease_2	40 → 468	Amino acid permease	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta, and skeletal muscle. {ECO:0000269|PubMed:10863037}.
• Sequence:

  MAGHTQQPSGRGNPRPAPSPSPVPGTVPGASERVALKKEIGLLSACTIIIGNIIGSGIFI
  SPKGVLEHSGSVGLALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGF
  LLLWSAVLIMYPTSLAVISMTFSNYVLQPVFPNCIPPTTASRVLSMACLMLLTWVNSSSV
  RWATRIQDMFTGGKLLALSLIIGVGLLQIFQGHFEELRPSNAFAFWMTPSVGHLALAFLQ
  GSFAFSGWNFLNYVTEEMVDARKNLPRAIFISIPLVTFVYTFTNIAYFTAMSPQELLSSN
  AVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTYSRLCFSGAREGHLPSLLAMIHVR
  HCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLLLRWRRPALHRPI
  KVNLLIPVAYLVFWAFLLVFSFISEPMVCGVGVIIILTGVPIFFLGVFWRSKPKCVHRLT
  ESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ

• Sequence length: 523

Pathways

Reactome:

Basigin interactions
Amino acid transport across the plasma membrane