Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56301
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 7 member 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC7A10
Synonyms (NCBI Gene) Gene synonyms aliases	ASC1, HASC-1, asc-1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.11
Summary Summary of gene provided in NCBI Entrez Gene.	SLC7A10, in association with 4F2HC (SLC3A2; MIM 158070), mediates high-affinity transport of D-serine and several other neutral amino acids (Nakauchi et al., 2000 [PubMed 10863037]).[supplied by OMIM, Mar 2008]

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments
MIRT1366731	hsa-miR-1245b-5p	CLIP-seq
MIRT1366732	hsa-miR-3142	CLIP-seq
MIRT1366733	hsa-miR-621	CLIP-seq
MIRT1366734	hsa-miR-873	CLIP-seq
MIRT2108798	hsa-miR-4436b-3p	CLIP-seq
MIRT2108799	hsa-miR-4690-5p	CLIP-seq
MIRT1366733	hsa-miR-621	CLIP-seq
MIRT1366734	hsa-miR-873	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10863037
GO:0005886	Component	Plasma membrane	TAS	10734121
GO:0006865	Process	Amino acid transport	IEA
GO:0006865	Process	Amino acid transport	TAS	10734121
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IDA	10863037
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IBA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IEA
GO:0015194	Function	L-serine transmembrane transporter activity	TAS	10863037
GO:0015804	Process	Neutral amino acid transport	IDA	10863037
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015816	Process	Glycine transport	IEA
GO:0015825	Process	L-serine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10734121
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042941	Process	D-alanine transmembrane transport	IBA
GO:0042941	Process	D-alanine transmembrane transport	IEA
GO:0042942	Process	D-serine transmembrane transport	IBA
GO:0042942	Process	D-serine transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060094	Process	Positive regulation of synaptic transmission, glycinergic	IEA
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IEA
GO:1903444	Process	Negative regulation of brown fat cell differentiation	IEA

MIM	HGNC	e!Ensembl
607959	11058	ENSG00000130876

Protein

UniProt ID

Q9NS82

Protein name

Asc-type amino acid transporter 1 (Asc-1) (Solute carrier family 7 member 10)

Protein function

Associates with SLC3A2/4F2hc to form a functional heterodimeric complex that translocates small neutral L- and D-amino acids across the plasma membrane. Preferentially mediates exchange transport, but can also operate via facilitated diffusion (

PDB

8QEY , 8WNS , 8WNT , 8WNY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13520	AA_permease_2	40 → 468	Amino acid permease	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta, and skeletal muscle. {ECO:0000269|PubMed:10863037}.

Sequence

MAGHTQQPSGRGNPRPAPSPSPVPGTVPGASERVALKKEIGLLSACTIIIGNIIGSGIFI
SPKGVLEHSGSVGLALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGF
LLLWSAVLIMYPTSLAVISMTFSNYVLQPVFPNCIPPTTASRVLSMACLMLLTWVNSSSV
RWATRIQDMFTGGKLLALSLIIGVGLLQIFQGHFEELRPSNAFAFWMTPSVGHLALAFLQ
GSFAFSGWNFLNYVTEEMVDARKNLPRAIFISIPLVTFVYTFTNIAYFTAMSPQELLSSN
AVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTYSRLCFSGAREGHLPSLLAMIHVR
HCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLLLRWRRPALHRPI
KVNLLIPVAYLVFWAFLLVFSFISEPMVCGVGVIIILTGVPIFFLGVFWRSKPKCVHRLT
ESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ

Sequence length

523

Interactions

View interactions

	Reactome
			Basigin interactions Amino acid transport across the plasma membrane

Show/Hide Unknown Diseases (8)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Asthma	Asthma (childhood onset), Age of onset of adult onset asthma, Nonatopic asthma, Age of onset of childhood onset asthma, Atopic asthma, Asthma in any disease, Asthma (adult onset), Pediatric asthma, Asthma	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Dermatitis	Atopic dermatitis	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease (early onset), Inflammatory bowel disease (MTAG), Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Brain Diseases Metabolic	Associate	38203703
Liver Neoplasms	Associate	30398641
Muscular Atrophy Spinal	Associate	30398641
Neurodegenerative Diseases	Associate	30398641
Prostatitis	Associate	15292941
Sarcoma Endometrial Stromal	Associate	23178314
Small Cell Lung Carcinoma	Associate	39392394

SLC7A10 (solute carrier family 7 member 10)