Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	563
Gene name Gene Name - the full gene name approved by the HGNC.	Alpha-2-glycoprotein 1, zinc-binding
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AZGP1
Synonyms (NCBI Gene) Gene synonyms aliases	ZA2G, ZAG
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022028	hsa-miR-128-3p	Microarray	17612493
MIRT2179179	hsa-miR-188-3p	CLIP-seq
MIRT2179180	hsa-miR-3152-5p	CLIP-seq
MIRT2179181	hsa-miR-3691-3p	CLIP-seq
MIRT2179182	hsa-miR-4317	CLIP-seq
MIRT2179183	hsa-miR-888	CLIP-seq
MIRT2179184	hsa-miR-934	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA
GO:0004540	Function	RNA nuclease activity	NAS	10462714
GO:0005515	Function	Protein binding	IPI	16237761, 18930737, 28671123, 32296183, 35512704
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	IDA	9813179
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	10462714
GO:0008320	Function	Protein transmembrane transporter activity	NAS	6896906
GO:0009897	Component	External side of plasma membrane	IBA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071806	Process	Protein transmembrane transport	IEA

MIM	HGNC	e!Ensembl
194460	910	ENSG00000160862

Protein

UniProt ID

P25311

Protein name

Zinc-alpha-2-glycoprotein (Zn-alpha-2-GP) (Zn-alpha-2-glycoprotein)

Protein function

Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. May bind polyunsaturated fatty acids.

PDB

1T7V , 1T7W , 1T7X , 1T7Y , 1T7Z , 1T80 , 1ZAG , 3ES6 , 6R2U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00129	MHC_I	26 → 201	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
PF07654	C1-set	208 → 287	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Blood plasma, seminal plasma, urine, saliva, sweat, epithelial cells of various human glands, liver.

Sequence

MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFR
YNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR
FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKA
YLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWT
RAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS

Sequence length

298

Interactions

View interactions

	Reactome
			Miscellaneous transport and binding events

AZGP1 (alpha-2-glycoprotein 1, zinc-binding)