Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56034
Gene name Gene Name - the full gene name approved by the HGNC.
Platelet derived growth factor C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDGFC
Synonyms (NCBI Gene) Gene synonyms aliases
FALLOTEIN, SCDGF
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product ap
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019758 hsa-miR-375 Microarray 20215506
MIRT022407 hsa-miR-124-3p Microarray 18668037
MIRT025672 hsa-miR-7-5p Microarray 17612493
MIRT040332 hsa-miR-615-3p CLASH 23622248
MIRT438913 hsa-miR-29b-3p Luciferase reporter assay, qRT-PCR 23354167
Transcription factors
Transcription factor Regulation Reference
EGR1 Activation 15247255
SP1 Unknown 15247255
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005161 Function Platelet-derived growth factor receptor binding IBA
GO:0005161 Function Platelet-derived growth factor receptor binding IEA
GO:0005161 Function Platelet-derived growth factor receptor binding IPI 10806482
GO:0005515 Function Protein binding IPI 10806482, 11297552, 20534510, 35384245
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608452 8801 ENSG00000145431
Protein
UniProt ID Q9NRA1
Protein name Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into: Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC rec
Protein function Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00431 CUB 47 160 CUB domain Domain
PF00341 PDGF 250 337 PDGF/VEGF domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract. Highly expressed in retinal pigment epithelia. Expressed in medulloblastoma. In the
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHY
NIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDC
VCRGSTGG
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Prostate cancer
Melanoma
Choline metabolism in cancer
  Signaling by PDGF
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cervical Cancer Cervical cancer N/A N/A GWAS
Diabetes Type 2 diabetes (PheCode 250.2), Type 2 diabetes (adjusted for BMI), Type 2 diabetes N/A N/A GWAS
Hypertension Hypertension, Hypertension (PheCode 401) N/A N/A GWAS
Lung adenocarcinoma Lung adenocarcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 37291580
Blood Platelet Disorders Associate 26367242
Brain Ischemia Associate 25849290
Breast Neoplasms Inhibit 22939885
Breast Neoplasms Stimulate 25383675
Breast Neoplasms Associate 26456994, 31542979
Cardiovascular Diseases Stimulate 31739742
Chondrosarcoma Associate 36359873
Cleft Lip Associate 19092777, 23029525
Cleft Palate Associate 19092777, 19401770