Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56034
Gene name	Platelet derived growth factor C
Gene symbol	PDGFC
Synonyms (NCBI Gene)	FALLOTEINSCDGF
Chromosome	4
Chromosome location	4q32.1
Summary	The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product ap

Show/Hide all (96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019758	hsa-miR-375	Microarray	20215506
MIRT022407	hsa-miR-124-3p	Microarray	18668037
MIRT025672	hsa-miR-7-5p	Microarray	17612493
MIRT040332	hsa-miR-615-3p	CLASH	23622248
MIRT438913	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT438913	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT732494	hsa-miR-29a-5p	Western blottingImmunocytochemistry (ICC)Luciferase reporter assayqRT-PCR	31482267
MIRT019758	hsa-miR-375	Western blottingMicroarrayImmunohistochemistry (IHC)qRT-PCR	32616906
MIRT1221209	hsa-miR-3671	CLIP-seq
MIRT1221210	hsa-miR-548p	CLIP-seq
MIRT1221211	hsa-miR-607	CLIP-seq
MIRT2063838	hsa-miR-127-5p	CLIP-seq
MIRT2063839	hsa-miR-4635	CLIP-seq
MIRT2063838	hsa-miR-127-5p	CLIP-seq
MIRT2292314	hsa-miR-3674	CLIP-seq
MIRT2292315	hsa-miR-376c	CLIP-seq
MIRT2292316	hsa-miR-4464	CLIP-seq
MIRT2063839	hsa-miR-4635	CLIP-seq
MIRT2292317	hsa-miR-4731-3p	CLIP-seq
MIRT2292318	hsa-miR-4748	CLIP-seq
MIRT2292319	hsa-miR-4801	CLIP-seq
MIRT2292320	hsa-miR-548aa	CLIP-seq
MIRT2292321	hsa-miR-548ac	CLIP-seq
MIRT2292322	hsa-miR-548ae	CLIP-seq
MIRT2292323	hsa-miR-548aj	CLIP-seq
MIRT2292324	hsa-miR-548am	CLIP-seq
MIRT2292325	hsa-miR-548d-3p	CLIP-seq
MIRT2292326	hsa-miR-548x	CLIP-seq
MIRT2292327	hsa-miR-548z	CLIP-seq
MIRT2456133	hsa-miR-4666-5p	CLIP-seq
MIRT2590060	hsa-miR-106a	CLIP-seq
MIRT2590061	hsa-miR-106b	CLIP-seq
MIRT2590062	hsa-miR-1245b-5p	CLIP-seq
MIRT2590063	hsa-miR-1276	CLIP-seq
MIRT2590064	hsa-miR-1295	CLIP-seq
MIRT2590065	hsa-miR-138	CLIP-seq
MIRT2590066	hsa-miR-142-5p	CLIP-seq
MIRT2590067	hsa-miR-17	CLIP-seq
MIRT2590068	hsa-miR-1976	CLIP-seq
MIRT2590069	hsa-miR-20a	CLIP-seq
MIRT2590070	hsa-miR-20b	CLIP-seq
MIRT2590071	hsa-miR-3124-3p	CLIP-seq
MIRT2590072	hsa-miR-3133	CLIP-seq
MIRT2590073	hsa-miR-3142	CLIP-seq
MIRT2590074	hsa-miR-3183	CLIP-seq
MIRT2590075	hsa-miR-323-3p	CLIP-seq
MIRT2590076	hsa-miR-3609	CLIP-seq
MIRT2590077	hsa-miR-3681	CLIP-seq
MIRT2590078	hsa-miR-3692	CLIP-seq
MIRT2590079	hsa-miR-371-5p	CLIP-seq
MIRT2590080	hsa-miR-371b-5p	CLIP-seq
MIRT2590081	hsa-miR-374c	CLIP-seq
MIRT2590082	hsa-miR-4279	CLIP-seq
MIRT2590083	hsa-miR-4299	CLIP-seq
MIRT2590084	hsa-miR-4421	CLIP-seq
MIRT2590085	hsa-miR-4511	CLIP-seq
MIRT2590086	hsa-miR-4661-5p	CLIP-seq
MIRT2590087	hsa-miR-4684-3p	CLIP-seq
MIRT2590088	hsa-miR-4699-5p	CLIP-seq
MIRT2590089	hsa-miR-4709-3p	CLIP-seq
MIRT2590090	hsa-miR-4714-5p	CLIP-seq
MIRT2590091	hsa-miR-4723-3p	CLIP-seq
MIRT2590092	hsa-miR-4738-3p	CLIP-seq
MIRT2590093	hsa-miR-4753-5p	CLIP-seq
MIRT2590094	hsa-miR-4766-5p	CLIP-seq
MIRT2590095	hsa-miR-4775	CLIP-seq
MIRT2590096	hsa-miR-4796-3p	CLIP-seq
MIRT2590097	hsa-miR-4802-3p	CLIP-seq
MIRT2590098	hsa-miR-519d	CLIP-seq
MIRT2590099	hsa-miR-548ah	CLIP-seq
MIRT2590100	hsa-miR-590-3p	CLIP-seq
MIRT2590101	hsa-miR-618	CLIP-seq
MIRT2590102	hsa-miR-655	CLIP-seq
MIRT2590103	hsa-miR-93	CLIP-seq
MIRT2590062	hsa-miR-1245b-5p	CLIP-seq
MIRT2590064	hsa-miR-1295	CLIP-seq
MIRT2590065	hsa-miR-138	CLIP-seq
MIRT2590068	hsa-miR-1976	CLIP-seq
MIRT2590071	hsa-miR-3124-3p	CLIP-seq
MIRT2590072	hsa-miR-3133	CLIP-seq
MIRT2590073	hsa-miR-3142	CLIP-seq
MIRT2590075	hsa-miR-323-3p	CLIP-seq
MIRT2590077	hsa-miR-3681	CLIP-seq
MIRT2590078	hsa-miR-3692	CLIP-seq
MIRT2590081	hsa-miR-374c	CLIP-seq
MIRT2590082	hsa-miR-4279	CLIP-seq
MIRT2590083	hsa-miR-4299	CLIP-seq
MIRT2590084	hsa-miR-4421	CLIP-seq
MIRT2590085	hsa-miR-4511	CLIP-seq
MIRT2590086	hsa-miR-4661-5p	CLIP-seq
MIRT2590089	hsa-miR-4709-3p	CLIP-seq
MIRT2590092	hsa-miR-4738-3p	CLIP-seq
MIRT2590095	hsa-miR-4775	CLIP-seq
MIRT2590097	hsa-miR-4802-3p	CLIP-seq
MIRT2590100	hsa-miR-590-3p	CLIP-seq
MIRT2590102	hsa-miR-655	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
EGR1	Activation	15247255
SP1	Unknown	15247255

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IBA
GO:0005161	Function	Platelet-derived growth factor receptor binding	IEA
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	10806482
GO:0005515	Function	Protein binding	IPI	10806482, 11297552, 20534510, 35384245
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10806482
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007417	Process	Central nervous system development	TAS	10858496
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10806482
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009986	Component	Cell surface	IDA	10806482
GO:0016020	Component	Membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0042803	Function	Protein homodimerization activity	IPI	10806482
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IBA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IDA	10806482
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	10806482
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0060348	Process	Bone development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	27492130

MIM	HGNC	e!Ensembl
608452	8801	ENSG00000145431

Q9NRA1

Protein name

Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into: Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC rec

Protein function

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00431	CUB	47 → 160	CUB domain	Domain
PF00341	PDGF	250 → 337	PDGF/VEGF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract. Highly expressed in retinal pigment epithelia. Expressed in medulloblastoma. In the

Sequence

MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Sequence length

345

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway Phospholipase D signaling pathway PI3K-Akt signaling pathway Focal adhesion Gap junction Regulation of actin cytoskeleton Prostate cancer Melanoma Choline metabolism in cancer		Signaling by PDGF

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
PDGFC-related disorder	Likely benign	rs114678449, rs149931440	RCV003934078 RCV003954733

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Autism Spectrum Disorder	Associate	37291580
Blood Platelet Disorders	Associate	26367242
Brain Ischemia	Associate	25849290
Breast Neoplasms	Inhibit	22939885
Breast Neoplasms	Stimulate	25383675
Breast Neoplasms	Associate	26456994, 31542979
Cardiovascular Diseases	Stimulate	31739742
Chondrosarcoma	Associate	36359873
Cleft Lip	Associate	19092777, 23029525
Cleft Palate	Associate	19092777, 19401770
Colorectal Neoplasms	Stimulate	26537064
Colorectal Neoplasms	Associate	35991839
Diabetes Mellitus	Inhibit	25849290
Diabetes Mellitus Type 2	Associate	31739742
Diabetic Angiopathies	Associate	25849290
Fibroma Desmoplastic	Associate	15365564
Gastrointestinal Stromal Tumors	Associate	19366796, 33603171
Glioblastoma	Associate	38167429
Glioma	Associate	20018898
Hereditary leiomyomatosis and renal cell cancer	Stimulate	17482170
Hyperglycemia	Associate	25849290
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	25849290
Hypoxia	Inhibit	15911618
Inflammatory Bowel Diseases	Associate	37291580
Leiomyoma	Associate	15374708
Lymphatic Metastasis	Associate	25383675
Lymphatic Metastasis	Stimulate	31542979
Mesothelioma Malignant	Associate	15920167
Neoplasm Metastasis	Associate	33603171
Neoplasms	Stimulate	15365564
Neoplasms	Associate	18758297, 19366796, 25383675, 29932922, 33603171, 35991839, 36359873
Orofacial Cleft 1	Associate	23029525
Ovarian Neoplasms	Associate	21118967
Pancreatic Neoplasms	Associate	35422475
Polycystic Ovary Syndrome	Associate	39253602
Radiation Injuries	Associate	24512807
Radiculopathy	Associate	28260009
Rhabdomyosarcoma	Associate	19366796
Thyroid Cancer Papillary	Associate	19968886
Uniparental Disomy	Associate	23029525
Vascular Diseases	Associate	36901825
Vitreoretinopathy Proliferative	Associate	19032953

PDGFC (platelet derived growth factor C)